Protein Info for EX28DRAFT_1056 in Enterobacter asburiae PDN3

Annotation: ABC-type polar amino acid transport system, ATPase component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 PF00005: ABC_tran" amino acids 24 to 182 (159 residues), 126.2 bits, see alignment E=2.2e-40 PF13304: AAA_21" amino acids 152 to 213 (62 residues), 36.1 bits, see alignment E=1.1e-12

Best Hits

Swiss-Prot: 53% identical to GLUA_COREF: Glutamate transport ATP-binding protein GluA (gluA) from Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)

KEGG orthology group: None (inferred from 98% identity to enc:ECL_01877)

Predicted SEED Role

"Amino acid ABC transporter, ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (257 amino acids)

>EX28DRAFT_1056 ABC-type polar amino acid transport system, ATPase component (Enterobacter asburiae PDN3)
MQASPEGHISITGVSKFFGRHKALDNVSLEIPPGSVTVILGPSGSGKSTLLRTINHLERV
DEGFIQIDGDYIGYRRQGDKLYELKEKEILKQRVNVGYVFQNFNLFPHLTVLENLIEAPI
AHKKLSKKEAVERAYSLLDVVGLRDKADAWSRHLSGGQQQRIAIARALALRPRVMLFDEP
TSALDPELVGEVLDVIKKLARSGTTLVVVTHEIGFAREVADQVVFMVDGKIVEQGSSDEV
LNRPSHARTRQFLSKVL