Protein Info for EX28DRAFT_1048 in Enterobacter asburiae PDN3

Annotation: PAS domain S-box

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 511 transmembrane" amino acids 169 to 187 (19 residues), see Phobius details amino acids 193 to 210 (18 residues), see Phobius details PF00989: PAS" amino acids 20 to 112 (93 residues), 29.1 bits, see alignment E=1.7e-10 TIGR00229: PAS domain S-box protein" amino acids 20 to 123 (104 residues), 48.8 bits, see alignment E=3.8e-17 PF13426: PAS_9" amino acids 21 to 113 (93 residues), 41 bits, see alignment E=4e-14 PF08447: PAS_3" amino acids 31 to 103 (73 residues), 44.5 bits, see alignment E=3e-15 PF00015: MCPsignal" amino acids 321 to 477 (157 residues), 156.3 bits, see alignment E=1.4e-49

Best Hits

KEGG orthology group: K03776, aerotaxis receptor (inferred from 81% identity to ent:Ent638_2094)

Predicted SEED Role

"Aerotaxis sensor receptor protein" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (511 amino acids)

>EX28DRAFT_1048 PAS domain S-box (Enterobacter asburiae PDN3)
MRRNSPVTQNEYLLNDGSTLMSTTDTKSHITYANSAFIEASGYKEEHLLGEPHNLIRHPD
MPAEAFGDMWFTLQQGETWTGLVKNRRHNGDHYWVRANVTPVWQGGSLTGYISVRNIPAR
EEIAASEKLYAKVRNNELKHYRFYKGLLVRRGLFSFMSLFKCLSTSKRIHLGIATTALLS
CLAVYLFPDKLVQSGSLVLLFTSLAYYLHAQIARPVKSIVQQMQSVVSGRKTDYYHFDRI
DDIGLMMRLVNQSGLNLNSLVDDVGAQISGIGTISQQVAKEGAALQTRSEETADFLQQTA
SAVEEIASAVKQTAETAKEATEMADRTRDSAHRGEAMMKETIGMMQSVSQDNSQIVDIIS
VIDRIAFQTNILALNAAVEAARAGEAGRGFAVVAAEVRNLAQHSATAAKEIKALIEKNVA
SVNAGVEKVEQTETQLTVMIDNVLRVSSLIKEIGHATQEQTQALTLINASISRIGAMTHN
NTGMVDNVTHAANHLTQRTTRLQQAIAVFGG