Protein Info for EX28DRAFT_1004 in Enterobacter asburiae PDN3

Annotation: Mg2+ and Co2+ transporters

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 transmembrane" amino acids 269 to 291 (23 residues), see Phobius details amino acids 300 to 321 (22 residues), see Phobius details PF01544: CorA" amino acids 39 to 323 (285 residues), 246.4 bits, see alignment E=2e-77

Best Hits

Swiss-Prot: 92% identical to ZNTB_ENT38: Zinc transport protein ZntB (zntB) from Enterobacter sp. (strain 638)

KEGG orthology group: K03284, metal ion transporter, MIT family (inferred from 97% identity to enc:ECL_01828)

MetaCyc: 88% identical to Zn2+:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-346

Predicted SEED Role

"Zinc transport protein ZntB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (327 amino acids)

>EX28DRAFT_1004 Mg2+ and Co2+ transporters (Enterobacter asburiae PDN3)
MESIKGSELNVPDAVFAWVLDGRGGARPLEDNDVIDSAHPCWLHLNYTHPDSADWLASTP
LLPNNVRDALAGESLRPRVSRMGDGTLITLRCINGSTDERPDQLVAMRVYMDDGLIVSTR
QRKVLALDDIVNDLKEGTGPVDCGSWLVDVCDALTDHASEFIEELHDKIIDLEDNLLDQQ
IPPRGFLALLRKQLIVMRRYMTPQRDVYARLASERLAWMNDDQRRRMQDIADRLGRGLDE
IDSCIARTAVMADEIAQVMQESLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGAYR
YGFTAFCVMLVVLIGGVAWWLHRSKWL