Protein Info for EX28DRAFT_0998 in Enterobacter asburiae PDN3

Annotation: Predicted carboxypeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 PF00246: Peptidase_M14" amino acids 38 to 157 (120 residues), 44.1 bits, see alignment E=1e-15

Best Hits

Swiss-Prot: 87% identical to MPAA_ECOLI: Murein peptide amidase A (mpaA) from Escherichia coli (strain K12)

KEGG orthology group: K14054, protein MpaA (inferred from 91% identity to enc:ECL_01798)

MetaCyc: 87% identical to murein tripeptide amidase A (Escherichia coli K-12 substr. MG1655)
RXN0-961

Predicted SEED Role

"Gamma-D-Glutamyl-meso-Diaminopimelate Amidase"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (237 amino acids)

>EX28DRAFT_0998 Predicted carboxypeptidase (Enterobacter asburiae PDN3)
MAITRPRAERGAFPPGAEQYGRSFLGASLIWFPAPDADRNSGLVIAGTHGDENSSIVTLS
CALRTLTPSLRRHHVILAVNPDGCQLGLRANARGIDLNRNFPAANWRAGETVYRWNSSAE
ERDVVLLTGDKPGSEPETQALCQLIHKIHPAWVVSFHDPLACIEDPRHSELGAWLAQAFA
LPLVTSVGYETPGSFGSWCADLSLPCITAEFPPISSDEASEIYLKAMMELLRWQPQR