Protein Info for EX28DRAFT_0981 in Enterobacter asburiae PDN3

Annotation: ABC-type sugar transport system, periplasmic component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF01547: SBP_bac_1" amino acids 40 to 327 (288 residues), 119.8 bits, see alignment E=2.4e-38 PF13416: SBP_bac_8" amino acids 48 to 355 (308 residues), 93 bits, see alignment E=3e-30

Best Hits

Swiss-Prot: 76% identical to YCJN_ECOLI: Putative ABC transporter periplasmic-binding protein YcjN (ycjN) from Escherichia coli (strain K12)

KEGG orthology group: K02027, multiple sugar transport system substrate-binding protein (inferred from 92% identity to enc:ECL_01781)

Predicted SEED Role

"ABC-type sugar transport system, periplasmic binding protein YcjN" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (430 amino acids)

>EX28DRAFT_0981 ABC-type sugar transport system, periplasmic component (Enterobacter asburiae PDN3)
MKMPRIVLISALVSCALLSGCKDDKKSAVTIEFMHSSVEQERQAVITKLIEKFEKENPGI
TVKQVPVEEDAYNTKVITLARTGALPEVIEVSHDYAKVMDKEQLLDRKAIGEAIKAVGES
TFYDGILRVVRTEDGSAWTGVPVSAWLSGVWYHKDALAAAGIQEPHNWEQLLKASQRLND
PAKKHYGIALPTAESVMTEQAFSQFALSGGANVFDAKGNVDIDTPEMAKALAFYKDLAAT
TMPGSNDVMEIKDAFMNGSAPMAVYSTYILPAVFQDGNPANLGFVVPTETSSAVYGMVTS
LTITTGQTENETQAAEKFVTWMEQAQNATDWVMMSPGAALPVNKLVVGTDTWKNNDVIKA
FGQLPYELIAQFPNVQVFGAVGDKNFTRMGDVTGSGIISSMVHNVTVGKKDLSNTLSNSQ
KRLTDLISQR