Protein Info for EX28DRAFT_0975 in Enterobacter asburiae PDN3

Annotation: psp operon transcriptional activator PspF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 TIGR02974: psp operon transcriptional activator" amino acids 8 to 322 (315 residues), 523.9 bits, see alignment E=9e-162 PF14532: Sigma54_activ_2" amino acids 9 to 179 (171 residues), 63.5 bits, see alignment E=8.3e-21 PF00158: Sigma54_activat" amino acids 9 to 170 (162 residues), 208.4 bits, see alignment E=1.9e-65 PF07728: AAA_5" amino acids 31 to 168 (138 residues), 29.8 bits, see alignment E=1.7e-10 PF25601: AAA_lid_14" amino acids 180 to 248 (69 residues), 64.8 bits, see alignment E=1.6e-21 PF02954: HTH_8" amino acids 284 to 321 (38 residues), 33.5 bits, see alignment 8.4e-12

Best Hits

Swiss-Prot: 83% identical to PSPF_ECOLI: Psp operon transcriptional activator (pspF) from Escherichia coli (strain K12)

KEGG orthology group: K03974, psp operon transcriptional activator (inferred from 92% identity to enc:ECL_01775)

Predicted SEED Role

"Psp operon transcriptional activator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (325 amino acids)

>EX28DRAFT_0975 psp operon transcriptional activator PspF (Enterobacter asburiae PDN3)
MPGYKDNLLGEANSFLEVLEQVSRLAPLNKPVLIIGERGTGKELIANRLHYLSGRWDGPF
ISLNCAALNENLLDTELFGHEAGAFTGAQKRHPGRFERADGGTLFLDELATAPMLVQEKL
LRVIEYGELERVGGSQPLQVNVRLVCATNANLPEMVAEEKFRADLLDRLAFDVVQLPPLR
ERKSDIMLLADQFAIQMCRELGLPLFPGFSDYAQETLLAYHWPGNIRELKNVVERSVYRH
GSSETELDNIIIDPFQRSAPPLSAPTSSGDLPTLPLDLRHFQNDQEKQLLEQSLKTAKYN
QKRAAELLGLTYHQLRALLKKHQMR