Protein Info for EX28DRAFT_0960 in Enterobacter asburiae PDN3

Annotation: PAS domain S-box/diguanylate cyclase (GGDEF) domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 663 PF00989: PAS" amino acids 115 to 222 (108 residues), 29.5 bits, see alignment E=1.3e-10 TIGR00229: PAS domain S-box protein" amino acids 115 to 233 (119 residues), 52.7 bits, see alignment E=4.7e-18 PF13426: PAS_9" amino acids 124 to 225 (102 residues), 37.4 bits, see alignment E=5.3e-13 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 234 to 394 (161 residues), 121.5 bits, see alignment E=2.9e-39 PF00990: GGDEF" amino acids 237 to 390 (154 residues), 153.2 bits, see alignment E=1.1e-48 PF00563: EAL" amino acids 412 to 644 (233 residues), 228.9 bits, see alignment E=1.2e-71

Best Hits

Swiss-Prot: 80% identical to PDER_ECOLI: Cyclic di-GMP phosphodiesterase PdeR (pdeR) from Escherichia coli (strain K12)

KEGG orthology group: K14051, cyclic di-GMP phosphodiesterase Gmr [EC: 3.1.4.52] (inferred from 98% identity to enc:ECL_01754)

MetaCyc: 80% identical to cyclic di-GMP phosphodiesterase PdeR (Escherichia coli K-12 substr. MG1655)
Cyclic-guanylate-specific phosphodiesterase. [EC: 3.1.4.52]

Predicted SEED Role

"FIG00626766: hypothetical protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.4.52

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (663 amino acids)

>EX28DRAFT_0960 PAS domain S-box/diguanylate cyclase (GGDEF) domain (Enterobacter asburiae PDN3)
MMDDLEQNLLFRYMGTHSPWWRLSADSNALHLSTSENADVTQVVALDDEQADLIRHLTVI
TSSISMSLSLYGEDVPVHLVGRKITRNEWAGTASAWNDTPSVARDLAQGLSFAEQVVSEA
NSVIVILDRHGNIQRFNRLSEEYTGLKEQEVIGQNVFKLFMSRSEAAASKRNITGFFRNG
SSYEVERWIKTRKGQRLFLFRNKFVHSGSGKNEIFLICSGTDITEERRAQERLRVLANTD
TITGLPNRNAIHDLISDAIDNRGDTQVGVVYLDLDNFKKVNDAYGHMFGDQLLQAVALAI
LSCLDEEQVLARLGGDEFIVMATNTSQGSLEAMASRILTRLRQPFRIGLIEIYTGCSLGI
ALAPQHGNDRESVIRNADTAMYTAKENGRGKFCVFSPEMNQRVFEYLWLDTNLRKALDND
QLLIHYQPKITWRGEVRSLEALVRWQSPERGLIPPLEFISYAEESGLIVPLGRWVMLDVV
RQVAKWRDKGINLRVAVNVSARQLADQTIFSDLKQALKDLNFEYCPVDVELTESCLIENE
ELALSVIQQFSRLGAQIHLDDFGTGYSSLSQLARFPIDAIKLDQSFVRDIHKQSISQSLV
RAIVAVAQALNLQVIAEGVENAKEDAFLTKNGVNERQGFLFAKPMPAAAFERWLKRYQAR
NQR