Protein Info for EX28DRAFT_0950 in Enterobacter asburiae PDN3

Annotation: GTP cyclohydrolase II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 196 TIGR00505: GTP cyclohydrolase II" amino acids 5 to 194 (190 residues), 309.4 bits, see alignment E=4e-97 PF00925: GTP_cyclohydro2" amino acids 5 to 170 (166 residues), 227.9 bits, see alignment E=2.6e-72

Best Hits

Swiss-Prot: 97% identical to RIBA_KLEP3: GTP cyclohydrolase-2 (ribA) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K01497, GTP cyclohydrolase II [EC: 3.5.4.25] (inferred from 100% identity to enc:ECL_01744)

MetaCyc: 94% identical to GTP cyclohydrolase 2 (Escherichia coli K-12 substr. MG1655)
GTP cyclohydrolase II. [EC: 3.5.4.25]

Predicted SEED Role

"GTP cyclohydrolase II (EC 3.5.4.25)" in subsystem Molybdenum cofactor biosynthesis or Riboflavin, FMN and FAD metabolism (EC 3.5.4.25)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (196 amino acids)

>EX28DRAFT_0950 GTP cyclohydrolase II (Enterobacter asburiae PDN3)
MQLKRVAEAKLPTPWGDFLMVGFEELATGQDHVALVYGDISGQTPVLSRVHSECLTGDAL
FSLRCDCGFQLEAALSHIAEEGRGVLLYHRQEGRNIGLLNKIRAYALQDQGYDTVEANHQ
LGFAADERDFTLCADMFKLLGVDEVRLLTNNPKKVEILTEAGINIVERVPLIVGRNPKNA
HYLDTKAAKMGHLLKE