Protein Info for EX28DRAFT_0925 in Enterobacter asburiae PDN3

Annotation: Uncharacterised protein family (UPF0259)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 83 to 106 (24 residues), see Phobius details amino acids 116 to 138 (23 residues), see Phobius details amino acids 144 to 166 (23 residues), see Phobius details amino acids 187 to 208 (22 residues), see Phobius details amino acids 220 to 242 (23 residues), see Phobius details PF06790: UPF0259" amino acids 1 to 244 (244 residues), 356.7 bits, see alignment E=3.9e-111

Best Hits

Swiss-Prot: 95% identical to Y2284_ENT38: UPF0259 membrane protein Ent638_2284 (Ent638_2284) from Enterobacter sp. (strain 638)

KEGG orthology group: None (inferred from 98% identity to enc:ECL_01650)

Predicted SEED Role

"Membrane protein YciC, linked to IspA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (247 amino acids)

>EX28DRAFT_0925 Uncharacterised protein family (UPF0259) (Enterobacter asburiae PDN3)
MSITAKSVYRDTGNFFRNQFITFLLIALLCAFITVVLGHAFSPSDEQIASLSQGDHLAGS
VGLFELVQNMTPEQQQILLRASAASTFSGLIGNAILAGGVLLMIQLVSAGHRVSALRAIG
ASAPVLPKLFILIFLTTLLVQMGIMLVVVPGVLLAIVLSFAPVMVVQDKMGIFTAMRSSI
RLAWANMRLVAPAVIGWLLAKTLLLLFAPNFAVLTPNVGAVVANTLSNLISAVLLVYLFR
LYMLIRQ