Protein Info for EX28DRAFT_0878 in Enterobacter asburiae PDN3

Annotation: Site-specific recombinase XerD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 PF24624: Int_N" amino acids 57 to 156 (100 residues), 89.4 bits, see alignment E=2.2e-29 PF00589: Phage_integrase" amino acids 164 to 308 (145 residues), 72.5 bits, see alignment E=3.8e-24

Best Hits

Swiss-Prot: 77% identical to VINT_BPP2: Integrase (int) from Escherichia phage P2

KEGG orthology group: None (inferred from 77% identity to ecf:ECH74115_3066)

Predicted SEED Role

"Phage integrase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (336 amino acids)

>EX28DRAFT_0878 Site-specific recombinase XerD (Enterobacter asburiae PDN3)
MSVKKLDDGRYEVDIRPSGRNGKRIRRKFDKKSEAMAFEKHTQYNHHSKEWLSKPTDKRQ
LSELKELWWKLKGKHEEHGQSYLRKIERFETMTGNPCAFQITKSLITQYCAQRRGEGIKP
TTINRDLITLGGMFTTLIESELYNGEHPFRGFKKLKEQTAETGYLTLEEIDALLAALSGD
NRKIAVLCLSTGARWGEAARLKAENVIHNRVSFVKTKTNTPRTVPISDDVAAYVVGKTRG
FLFPEASYADFRRTLKEVKPDLPAGQATHALRHSFATHFMINGGNIITLQRILGHTKIAQ
TMVYAHFAPQYLQDAISLNPLKGANGGQSVHNVSTP