Protein Info for EX28DRAFT_0859 in Enterobacter asburiae PDN3
Annotation: Uncharacterized protein conserved in bacteria
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 83% identical to Y2310_ENT38: UPF0225 protein Ent638_2310 (Ent638_2310) from Enterobacter sp. (strain 638)
KEGG orthology group: K09858, SEC-C motif domain protein (inferred from 83% identity to ent:Ent638_2310)Predicted SEED Role
"UPF0225 protein YchJ"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (152 amino acids)
>EX28DRAFT_0859 Uncharacterized protein conserved in bacteria (Enterobacter asburiae PDN3) MSQLCPCGSALEYSLCCQRYLSGDQVAPDPSHLMRSRYTAFVIKDADYLIKTWHPSCHAD EFRQDIEAGFANTQWLGLTVYESSTGSHVDEGYVSFVARFSENNKPGAIIERSRFLKESG QWYYIDGTRPQFGRNDPCPCGSGKKFKKCCGQ