Protein Info for EX28DRAFT_0842 in Enterobacter asburiae PDN3

Annotation: ABC-type nitrate/sulfonate/bicarbonate transport systems, periplasmic components

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF13379: NMT1_2" amino acids 35 to 286 (252 residues), 349.4 bits, see alignment E=1.5e-108

Best Hits

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 91% identity to ent:Ent638_2325)

Predicted SEED Role

"Nitrate ABC transporter, nitrate-binding protein" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (415 amino acids)

>EX28DRAFT_0842 ABC-type nitrate/sulfonate/bicarbonate transport systems, periplasmic components (Enterobacter asburiae PDN3)
MADLSRRRFLQASMLASGAMLLPGVMQAAWAAGSDKPEQETVRIGFIPLTDCAPVVIAAL
KGFDKKYGITIVPTKEASWAAVRDKLVAGELDAAHILYGLLYGLELGIAGKPQQMANLMT
LNQNGQAITLSSDLAEKGVRDLDGLKKLIGQQVPGTYTFAHTFPTGTHAMWLYYWLASAG
INPFDDVRTVVVPPPQMVMNMRIGNMVGFCVGEPWNARAINDRIGFTAATSQSIWADHPE
KILGTRRDWVEKNPHTARALVSAVLEAARWIEASPENKRETAQILSRRAWLNCKEQYLTG
RMLGEYDNGLGQRWQDAHPIRFFNEGAVSYPYHSDGMWFLTQFRRWGLLKAAPDYAGIAQ
RINQTAVWQDAATAVGGITTPTSPLRSSTLMDGTVWNGTDPEGYANRFAIHRKGV