Protein Info for EX28DRAFT_0840 in Enterobacter asburiae PDN3

Annotation: Uncharacterized conserved protein involved in intracellular sulfur reduction

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 117 PF02635: DsrE" amino acids 2 to 117 (116 residues), 77 bits, see alignment E=6.7e-26

Best Hits

Swiss-Prot: 92% identical to YCHN_ECO57: Protein YchN (ychN) from Escherichia coli O157:H7

KEGG orthology group: K06039, uncharacterized protein involved in oxidation of intracellular sulfur (inferred from 92% identity to eco:b1219)

Predicted SEED Role

"Putative ACR protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (117 amino acids)

>EX28DRAFT_0840 Uncharacterized conserved protein involved in intracellular sulfur reduction (Enterobacter asburiae PDN3)
MQKIVIVANGAAYGSESLFNSLRLAIALREKESDLALRLFLMSDAVTAGLKGQKPAEGYN
IQQMLEILTAQNVPVKLCKTCTDGRGITGLPLIDGVEIGTLVELAEWTLSADKVLTF