Protein Info for EX28DRAFT_0832 in Enterobacter asburiae PDN3

Annotation: Uncharacterized protein conserved in bacteria

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 130 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 40 to 61 (22 residues), see Phobius details amino acids 73 to 93 (21 residues), see Phobius details amino acids 104 to 123 (20 residues), see Phobius details PF04247: SirB" amino acids 5 to 126 (122 residues), 129.7 bits, see alignment E=3.2e-42

Best Hits

Swiss-Prot: 72% identical to SIRB2_SALTY: Protein SirB2 (sirB2) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 94% identity to enc:ECL_01599)

Predicted SEED Role

"FIG002082: Protein sirB2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (130 amino acids)

>EX28DRAFT_0832 Uncharacterized protein conserved in bacteria (Enterobacter asburiae PDN3)
MSLFTVLITVHLISVALTVSFFIVRYWWRYSNNPLMDARWVRIAPHCIDTLLLLSGAGLM
WKTGYLPFTDKGAWLTEKLFGVIIYIVLGFIALGRRRPRSQQVGFIAFLLGLVVLYIIIK
LATTRIPLLG