Protein Info for EX28DRAFT_0814 in Enterobacter asburiae PDN3

Annotation: RHS repeat-associated core domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1000 1100 1200 1300 1400 1452 transmembrane" amino acids 29 to 51 (23 residues), see Phobius details amino acids 55 to 79 (25 residues), see Phobius details PF05488: PAAR_motif" amino acids 177 to 219 (43 residues), 33 bits, see alignment (E = 1.6e-11) PF20148: DUF6531" amino acids 293 to 367 (75 residues), 78.2 bits, see alignment 1.5e-25 PF25023: TEN_YD-shell" amino acids 451 to 627 (177 residues), 29.1 bits, see alignment E=8.9e-11 amino acids 1054 to 1302 (249 residues), 30.8 bits, see alignment E=2.7e-11 TIGR01643: YD repeat (two copies)" amino acids 483 to 524 (42 residues), 21.9 bits, see alignment (E = 1.8e-08) amino acids 570 to 609 (40 residues), 29.5 bits, see alignment (E = 7.6e-11) amino acids 591 to 631 (41 residues), 25 bits, see alignment (E = 1.9e-09) amino acids 640 to 674 (35 residues), 18.4 bits, see alignment (E = 2.5e-07) amino acids 677 to 708 (32 residues), 16.5 bits, see alignment (E = 9.3e-07) amino acids 697 to 737 (41 residues), 32.1 bits, see alignment (E = 1.2e-11) amino acids 739 to 778 (40 residues), 18.9 bits, see alignment (E = 1.6e-07) amino acids 760 to 798 (39 residues), 21.9 bits, see alignment (E = 1.8e-08) amino acids 781 to 810 (30 residues), 23.4 bits, see alignment (E = 6.5e-09) amino acids 869 to 898 (30 residues), 19 bits, see alignment (E = 1.5e-07) amino acids 921 to 957 (37 residues), 27.2 bits, see alignment (E = 3.8e-10) PF05593: RHS_repeat" amino acids 483 to 512 (30 residues), 26.3 bits, see alignment (E = 2.3e-09) amino acids 570 to 606 (37 residues), 22 bits, see alignment (E = 5.1e-08) amino acids 591 to 628 (38 residues), 30.3 bits, see alignment (E = 1.3e-10) amino acids 655 to 691 (37 residues), 25 bits, see alignment (E = 5.8e-09) amino acids 697 to 733 (37 residues), 40.3 bits, see alignment (E = 9.2e-14) amino acids 721 to 753 (33 residues), 34.9 bits, see alignment (E = 4.8e-12) amino acids 760 to 796 (37 residues), 26.9 bits, see alignment (E = 1.6e-09) amino acids 921 to 956 (36 residues), 33.2 bits, see alignment (E = 1.6e-11) PF03527: RHS" amino acids 1222 to 1258 (37 residues), 41.8 bits, see alignment (E = 2.4e-14) TIGR03696: RHS repeat-associated core domain" amino acids 1250 to 1328 (79 residues), 86.7 bits, see alignment 1.2e-28 PF15633: Tox-ART-HYD1" amino acids 1333 to 1444 (112 residues), 55.4 bits, see alignment 2.4e-18

Best Hits

KEGG orthology group: None (inferred from 94% identity to enc:ECL_01567)

Predicted SEED Role

"Rhs-family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (1452 amino acids)

>EX28DRAFT_0814 RHS repeat-associated core domain (Enterobacter asburiae PDN3)
MSDNNAARKGDEIIHSSIFADITSIVAEGAAYAVIGAAVGAAATVAAPLLGAGAAAAGVA
AIGSSCLLSGIIGGVLANVAGITDDISNAAEGLGNALFPPSPAGKITTGSSNVLTNAIPA
ARAAGTLTPADTPSPEPQSPGSFADYAGMLLSAAGQFGSEMWQPSVASAAAGTSPLEEDK
VACEKHSGPQYLAEGSKSVFINGQPAVRAKDRTTCEGTVSDDVSPNVIIGGDTLTVRDIK
SGKTPGLALGMIALSLLRGRPGKILKNMPCALAAAGGGMLADMAVNAVFGSSHPVHAATG
VKVLNDDDELDFSLPGRFPLRWQRSYNSLTTREGLFGLGWATTFDSYLVLEDNNATWFDE
TGRELSFELPPVDRAFYSISEGIIIRRNENGDVAIADDDGAVWRLYKPTRANPSILRLAS
LSDEYGNALLTEWDEHGRLVGLHDEPRAIDVTLRYDDERFPHRVTAASHFDGSQTWPLMR
WGYDASGQLASATDASGVVTREYRYNEHGLMVWHRMPGGLESEYRWKKFDHWRVVENRTS
TGDGCRFSYDLAAGLTTVEHYDGQTRRHYWNAQNLIVRYVDERGENWRYEWDDNELLTRR
IDPLGNAVTFVYDEMGNRVQEIDADGNTRTTAWLEHRALPAAIIEADGSATRFWYDEHHG
LKRVVDPMGQTTHLRRDEFGQVVEEVDAAGNSRYQEYNEAGQIVRATDCSGRITRYRYHP
LGWLVAETSADGEETRYRYDAAGRPVQLDRPEGWTESLKWNERGLPVKHAGADGKESEFR
YDEAGRLTATRNTQGEEVRRRWDSRGRLIALENENGEAYQFRWGADSLLLEEVGLDGVAS
QYRYDACGRTIARTFAAGHPEAITHAFAWSASGQLVARTTPEGQTRYHYTPAGLLSRIGL
HPALAADAWTTEAEQELAFEYDALGRVTREAGEHGELAWEYDALGNRTSVTLPDGRELKQ
FYYGSGHLLSIALDKLSVSDFTRDELHRETSRTQGLLTTRSEYDRLGRLHRRDVFTGNAQ
RPSPRRWSRRWDYDYRNNLVREERDDNPFSWYRWQYDSAGRLLVQDGTLPGQEQWRWDAA
GNPLEGAAEKVTHNRLTQLNSIRWRYDIHGRTVEKDNGQTRWHYRYDGEHRLTEVISQPR
DRNKPQTQVSFRYDPLGRRISKTRRQMLGGQPTGKPVTTRFVWEGFRLLQEVHGDVPLTY
VYSDQDSYDPLARIDGVDSPEIFWFHCQPNGTPERMTDIEGQVRWEGVNSAWGKLLRESE
TQVSGYSQNLRMQGQYLDRETGLHYNLFRYYDPDCGRFTQQDPIGLAGGINLYQYAPNAL
GWVDPWGLTPKTLIHYTTEEGMKGITESGVIRPSSGDIHARFGDGQYFTNIRPEMIGGRT
LKDVGGSGKMSLGQLAADIYGDARKLKGISHFVEIDVTGLDVIEPRKNTFLILNTKDLDV
SKRIVKSGRSCG