Protein Info for EX28DRAFT_0801 in Enterobacter asburiae PDN3

Annotation: Serine/threonine protein phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 PF13672: PP2C_2" amino acids 14 to 204 (191 residues), 36.9 bits, see alignment E=4.6e-13 PF00481: PP2C" amino acids 27 to 136 (110 residues), 25.4 bits, see alignment E=1.6e-09

Best Hits

KEGG orthology group: None (inferred from 99% identity to enc:ECL_01545)

Predicted SEED Role

"Protein serine/threonine phosphatase PrpC, regulation of stationary phase" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (265 amino acids)

>EX28DRAFT_0801 Serine/threonine protein phosphatase (Enterobacter asburiae PDN3)
MNIATASLSRQGTRASNQDQTGETIGERSACFVVCDGIAGLPGGEVAAELARNSIISRFD
GDKHLNAQHIRDYVQTANRTILSEQQAVQDYRRMGTTLVSLFIDRDYGLAYWAHAGDSRL
YLFRRGWLWHVTTDHSLVQQMKDAGHQTDDLNSNLLYLALGIENGGPEASYSDVVQVEDG
DAFLLCTDGFWHGVSEEQMKQSLHMVNTPQEWLTLMNQIIQKNGEQEGNAQDNYTALAVW
MGNPQDTTLLHTLSDAAQFLPCGTD