Protein Info for EX28DRAFT_0771 in Enterobacter asburiae PDN3

Annotation: Predicted glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 PF07317: PilZN" amino acids 8 to 109 (102 residues), 90.4 bits, see alignment E=6.8e-30 PF07238: PilZ" amino acids 112 to 229 (118 residues), 27.9 bits, see alignment E=2.4e-10

Best Hits

Swiss-Prot: 70% identical to YCGR_SALTY: Flagellar brake protein YcgR (ycgR) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 93% identity to enc:ECL_01518)

Predicted SEED Role

"Inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (243 amino acids)

>EX28DRAFT_0771 Predicted glycosyltransferase (Enterobacter asburiae PDN3)
MSHYSEQFLKQNPLAVLGVLRDLQKGEVPLRISWSNNQFISKILDASQDRLVIDLGSQEY
ENRAALKAENIAVMAETQGAKVEFVLSRLELSEYQGLPAFVTPLPTNLWFVQRREYFRIS
APLHPAYFCKAKMPDKKEIRFRLFDLSLGGMGALMDTPKPDGLVEGMRFTQIELDMGGWG
RFYFDAQLIAISDRTVVDSKNETITTPRLSFRFLNVGPGAERELQRIIYSLEREARERAN
KVL