Protein Info for EX28DRAFT_0751 in Enterobacter asburiae PDN3

Annotation: tRNA threonylcarbamoyl adenosine modification protein YeaZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 TIGR03725: tRNA threonylcarbamoyl adenosine modification protein YeaZ" amino acids 3 to 219 (217 residues), 230.5 bits, see alignment E=1.1e-72 PF00814: TsaD" amino acids 28 to 148 (121 residues), 99.2 bits, see alignment E=1.7e-32

Best Hits

Swiss-Prot: 83% identical to TSAB_ECOLI: tRNA threonylcarbamoyladenosine biosynthesis protein TsaB (tsaB) from Escherichia coli (strain K12)

KEGG orthology group: K14742, hypothetical protease [EC: 3.4.-.-] (inferred from 96% identity to enc:ECL_01496)

MetaCyc: 83% identical to N6-L-threonylcarbamoyladenine synthase, TsaB subunit (Escherichia coli K-12 substr. MG1655)
RXN-14570 [EC: 2.3.1.234]

Predicted SEED Role

"TsaB protein, required for threonylcarbamoyladenosine (t(6)A) formation in tRNA"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.4.-.-

Use Curated BLAST to search for 2.3.1.234 or 3.4.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (231 amino acids)

>EX28DRAFT_0751 tRNA threonylcarbamoyl adenosine modification protein YeaZ (Enterobacter asburiae PDN3)
MRILAIDTATEACSVALFNDGAVSAHFEECPREHTQRILPLVKAILTQGNTSLTDLDALA
FGRGPGSFTGVRIGIGIAQGLALGAELPMIGVSTLATMAQGAWRMTGATRVLAAIDARMG
EVYWAEYTRDEQGVWHGEETEAVLKPEAVTERLQQLSGEWATVGTGWPAWPDMANDTGVT
LVDGNMLLPAAEDMLPIACQLLAAGKTVAVEHAEPVYLRNTVAWKKLPGRE