Protein Info for EX28DRAFT_0747 in Enterobacter asburiae PDN3

Annotation: aminodeoxychorismate synthase, component I, bacterial clade

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04715: Anth_synt_I_N
  • amino acids 25 to 145 (121 residues), 71.6 bits, E=9.1e-24
• TIGR00553: aminodeoxychorismate synthase, component I
  • amino acids 99 to 439 (341 residues), 438 bits, E=1e-135
• PF00425: Chorismate_bind
  • amino acids 183 to 435 (253 residues), 298.1 bits, E=5.9e-93

Best Hits

Swiss-Prot: 74% identical to PABB_ECOLI: Aminodeoxychorismate synthase component 1 (pabB) from Escherichia coli (strain K12)

KEGG orthology group: K01665, para-aminobenzoate synthetase component I [EC: 2.6.1.85] (inferred from 87% identity to enc:ECL_01492)

MetaCyc: 74% identical to aminodeoxychorismate synthase subunit 1 (Escherichia coli K-12 substr. MG1655)
Aminodeoxychorismate synthase. [EC: 2.6.1.85]

Predicted SEED Role

"Para-aminobenzoate synthase, aminase component (EC 2.6.1.85)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Folate Biosynthesis (EC 2.6.1.85)

MetaCyc Pathways

• superpathway of chorismate metabolism (54/59 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (11/12 steps found)
• superpathway of tetrahydrofolate biosynthesis (9/10 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• 4-aminobenzoate biosynthesis I (2/2 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (3/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)
• L-glutamate and L-glutamine biosynthesis (5/7 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)
• superpathway of candicidin biosynthesis (4/11 steps found)
• chloramphenicol biosynthesis (1/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Folate biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.85

Use Curated BLAST to search for 2.6.1.85

Protein Sequence (444 amino acids)

>EX28DRAFT_0747 aminodeoxychorismate synthase, component I, bacterial clade (Enterobacter asburiae PDN3)
MPHMNMRFPTVITLPWRADAAEFWFARLSHLPYAMLLHSGHADHPYSRFDILVADPLKTL
TTDDLSLTDDPLKQLQQAINALGLSAAPNPDFPFQGGALGLFGYDLGRRFETLPEHAQAD
ISLPDMAVGLYDWALIVDHLKKKVSLLSHHDVQARLAWLEAQQPAPAQTFTLTSGWRSNM
SAAEYAEKFARVQAYLQSGDCYQVNLAQRFQATYRGDEWQAFTRLNASNKAPFSAFVRLE
RGAILSLSPERFIHLAEGTIQTRPIKGTLPRLADPDADRQQAEKLAASPKDRAENLMIVD
LMRNDIGRVAEPGSVRVPELFVVEPFPAVHHLVSTITARLPASRTACDLLRAAFPGGSIT
GAPKVRAMEIIDELEPHRRNAWCGSIGYISLCGTMDTSITIRTLTACDGNLYCSAGGGIV
ADSQVDAEYQETFDKVNRILKQLE