Protein Info for EX28DRAFT_0743 in Enterobacter asburiae PDN3

Annotation: Membrane protein TerC, possibly involved in tellurium resistance

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 519 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 47 to 69 (23 residues), see Phobius details amino acids 82 to 101 (20 residues), see Phobius details amino acids 122 to 147 (26 residues), see Phobius details amino acids 153 to 172 (20 residues), see Phobius details amino acids 184 to 206 (23 residues), see Phobius details amino acids 213 to 231 (19 residues), see Phobius details PF03741: TerC" amino acids 15 to 203 (189 residues), 157.1 bits, see alignment E=6e-50 PF00571: CBS" amino acids 369 to 419 (51 residues), 16.5 bits, see alignment 1.3e-06 PF03471: CorC_HlyC" amino acids 434 to 511 (78 residues), 56.9 bits, see alignment E=2.5e-19

Best Hits

Swiss-Prot: 88% identical to YOAE_ECOL6: UPF0053 inner membrane protein YoaE (yoaE) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 96% identity to enc:ECL_01488)

Predicted SEED Role

"Magnesium and cobalt efflux protein CorC" in subsystem Copper homeostasis: copper tolerance or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (519 amino acids)

>EX28DRAFT_0743 Membrane protein TerC, possibly involved in tellurium resistance (Enterobacter asburiae PDN3)
MEFLMDPSIWVGLLTLVVLEIVLGIDNLVFIAILADKLPPKQRDNARLIGLSLALVMRLG
LLSVISWMVTLTKPLFSVMDYTFSGRDLIMLIGGIFLLFKATTELHERLENRQHDDGHGK
GYASFWVVVMQIVVLDAVFSLDAVITAVGMVNHLPVMMAAVVIAMAVMLLASKPLTRFVN
QHPTVVVLCLSFLLMIGLSLVAEGFGFHIPKGYLYAAIGFSILIELFNQIARRNFIKQQS
NQPLRARTADAILRLMGGRRQVNVQSDSENHNPVPVPEGAFVEQERYMINGVLSLASRSL
RGIMTPRGEISWVDANLSVDEIRQQLLSSPHSLFPVCRGELDEIIGVVRAKEMLVALEEG
VNVEAVAAASPAIVVPETLDPINLLGVLRRARGSFVIVTNEFGVVQGLVTPLDVLEAIAG
EFPDADETPEIVADGEGWLVKGTTDLHALSHTLGLENVINDEEDIATVAGLVIAVNGQIP
RVGDVIELGPLHITIVEANDYRVDMVRIVKEQSAHDEDE