Protein Info for EX28DRAFT_0712 in Enterobacter asburiae PDN3

Annotation: DNA polymerase III, theta subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF06440: DNA_pol3_theta
  • amino acids 2 to 71 (70 residues), 129.3 bits, E=1.8e-42

Best Hits

Swiss-Prot: 88% identical to HOLE_ECO57: DNA polymerase III subunit theta (holE) from Escherichia coli O157:H7

KEGG orthology group: K02345, DNA polymerase III subunit theta [EC: 2.7.7.7] (inferred from 100% identity to enc:ECL_01454)

MetaCyc: 88% identical to DNA polymerase III subunit theta (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"DNA polymerase III theta subunit (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Protein Sequence (76 amino acids)

>EX28DRAFT_0712 DNA polymerase III, theta subunit (Enterobacter asburiae PDN3)
MKINLAALPQDEMDKVNVDLAAAGVAFKERYNMPIVAEVVEREQPAHLRDWFRERLIAHR
LASVNLSRLPYEPKVK