Protein Info for EX28DRAFT_0707 in Enterobacter asburiae PDN3

Annotation: formate-dependent phosphoribosylglycinamide formyltransferase (EC 6.3.4.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01142: phosphoribosylglycinamide formyltransferase 2
  • amino acids 14 to 390 (377 residues), 621.8 bits, E=2e-191
• PF02222: ATP-grasp
  • amino acids 123 to 294 (172 residues), 180.9 bits, E=3.4e-57
• PF02786: CPSase_L_D2
  • amino acids 133 to 198 (66 residues), 25.6 bits, E=1.7e-09
• PF07478: Dala_Dala_lig_C
  • amino acids 137 to 285 (149 residues), 27.1 bits, E=5.7e-10
• PF21244: PurT_C
  • amino acids 321 to 388 (68 residues), 96.9 bits, E=7.8e-32

Best Hits

Swiss-Prot: 85% identical to PURT_SHISS: Formate-dependent phosphoribosylglycinamide formyltransferase (purT) from Shigella sonnei (strain Ss046)

KEGG orthology group: K08289, phosphoribosylglycinamide formyltransferase 2 [EC: 2.1.2.2] (inferred from 96% identity to enc:ECL_01449)

MetaCyc: 85% identical to phosphoribosylglycinamide formyltransferase 2 (Escherichia coli K-12 substr. MG1655)
GARTRANSFORMYL2-RXN [EC: 6.3.1.21]; Acetate kinase. [EC: 6.3.1.21, 2.7.2.1, 2.7.2.15]

Predicted SEED Role

"Phosphoribosylglycinamide formyltransferase 2 (EC 2.1.2.-)" in subsystem De Novo Purine Biosynthesis (EC 2.1.2.-)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (46/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (26/26 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• mixed acid fermentation (16/16 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (18/19 steps found)
• superpathway of N-acetylneuraminate degradation (19/22 steps found)
• superpathway of L-threonine metabolism (16/18 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (9/9 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (11/12 steps found)
• L-threonine degradation I (6/6 steps found)
• superpathway of 5-aminoimidazole ribonucleotide biosynthesis (6/6 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis I (5/5 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis II (5/5 steps found)
• Bifidobacterium shunt (12/15 steps found)
• pyruvate fermentation to acetate I (3/3 steps found)
• pyruvate fermentation to acetate II (3/3 steps found)
• pyruvate fermentation to acetate IV (3/3 steps found)
• pyruvate fermentation to acetate VII (3/3 steps found)
• superpathway of acetate utilization and formation (3/3 steps found)
• acetate and ATP formation from acetyl-CoA I (2/2 steps found)
• tetrahydrofolate salvage from 5,10-methenyltetrahydrofolate (2/2 steps found)
• acetylene degradation (anaerobic) (4/5 steps found)
• ethanolamine utilization (4/5 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (3/4 steps found)
• pyruvate fermentation to acetate and lactate II (3/4 steps found)
• glycine degradation (reductive Stickland reaction) (1/2 steps found)
• reductive glycine pathway of autotrophic CO₂ fixation (6/9 steps found)
• superpathway of Clostridium acetobutylicum acidogenic fermentation (6/9 steps found)
• (S)-propane-1,2-diol degradation (3/5 steps found)
• lactate fermentation to acetate, CO₂ and hydrogen (Desulfovibrionales) (5/8 steps found)
• acetyl-CoA fermentation to butanoate (4/7 steps found)
• methanogenesis from acetate (3/6 steps found)
• superpathway of L-alanine fermentation (Stickland reaction) (5/9 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (7/13 steps found)
• L-lysine fermentation to acetate and butanoate (3/10 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (8/17 steps found)
• purine nucleobases degradation II (anaerobic) (13/24 steps found)
• purine nucleobases degradation I (anaerobic) (6/15 steps found)
• gallate degradation III (anaerobic) (3/11 steps found)
• superpathway of methanogenesis (3/21 steps found)
• superpathway of L-lysine degradation (12/43 steps found)

KEGG Metabolic Maps

• Nucleotide sugars metabolism
• One carbon pool by folate
• Propanoate metabolism
• Purine metabolism
• Pyruvate metabolism
• Taurine and hypotaurine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.1.2.2, 2.7.2.1, 2.7.2.15

Use Curated BLAST to search for 2.1.2.- or 2.1.2.2 or 2.7.2.1 or 2.7.2.15 or 6.3.1.21

Protein Sequence (392 amino acids)

>EX28DRAFT_0707 formate-dependent phosphoribosylglycinamide formyltransferase (EC 6.3.4.-) (Enterobacter asburiae PDN3)
MIRLGTALRPAATRVMLLGSGELGKEVAIECQRLGVEVIAVDRYADAPAMHVAHRSYVIN
MLDGDALRELITREKPDCVVPEIEAIATDTLIALEQEGQRVVPCAKAAKLTMNREGIRRL
AAEELGLPTSSYRFAGDKAAFLQAVEEIGYPCIVKPVMSSSGKGQSFIRDSGTLDNAWDY
AQQGGRAGAGRVIVEGVVKFDFEITLLTVSAVDGVHFCDPIGHRQEDGDYRESWQPQQMS
ALALERAQDIARKTVLALGGYGLFGVELFVCGDEVIFSEVSPRPHDTGMVTLISQDLSEF
ALHVRAFLGLPVGGVRQYGPAASAVILPQLTSQNVTFDNVDGAVGAGLQVRLFGKPEIDG
TRRLGVALATGDNVDDAVARAKAAAASVKVAG