Protein Info for EX28DRAFT_0700 in Enterobacter asburiae PDN3

Annotation: Membrane proteins related to metalloendopeptidases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details PF08525: OapA_N" amino acids 12 to 39 (28 residues), 38 bits, see alignment (E = 3.3e-13) PF04225: LysM_OapA" amino acids 96 to 170 (75 residues), 27.8 bits, see alignment E=6.5e-10 PF01476: LysM" amino acids 98 to 141 (44 residues), 26.1 bits, see alignment 2e-09 PF19425: Csd3_N2" amino acids 179 to 300 (122 residues), 221.6 bits, see alignment E=6.1e-70 PF01551: Peptidase_M23" amino acids 312 to 406 (95 residues), 120.4 bits, see alignment E=9e-39

Best Hits

Swiss-Prot: 90% identical to MEPM_ECOL6: Murein DD-endopeptidase MepM (mepM) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 97% identity to enc:ECL_01442)

MetaCyc: 90% identical to peptidoglycan endopeptidase MepM (Escherichia coli K-12 substr. MG1655)
3.4.-.-; 3.4.-.-

Predicted SEED Role

"Cell wall endopeptidase, family M23/M37"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (439 amino acids)

>EX28DRAFT_0700 Membrane proteins related to metalloendopeptidases (Enterobacter asburiae PDN3)
MQQIARSVALAFNNLPRPHRVMLGSLTVLTLAVAVWRPYVYHPSSAPIIKTIELEKSEIR
SLLPEASEPIDQAAQEDEAIPQDELDDKTENEAGIHEYVVSTGDTLSSVLNQYGIDMGNI
SQLAAADKDLRNLKIGQQLSWTLTADGDLQRLTWEMSRRETRTYDRTANGFKMTSEMQKG
DWVNSVLKGTVGASFVSSARDAGLTSAEISSVIKAMQWQMDFRKLKKGDEFSVLMSREML
DGKREQSQLLGVRLRSEGKDYYAIRAEDGKFYDRTGTGLAKGFLRFPTAKQFRVSSNFNP
RRLNPVTGRVAPHRGVDFAMPQGTPVLAVGDGEVVVAKRSGAAGYYVAVRHGRTYTTRYM
HLRKLLVKPGQKVKRGDRIAISGNTGRSTGPHLHYEVWINQQAVNPLTAKLPRTEGLTGK
DRTDYLAQVKEVMPQLSLN