Protein Info for EX28DRAFT_0699 in Enterobacter asburiae PDN3

Annotation: ABC-type Zn2+ transport system, periplasmic component/surface adhesin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01297: ZnuA
  • amino acids 33 to 315 (283 residues), 219 bits, E=4.3e-69

Best Hits

Swiss-Prot: 84% identical to ZNUA_ECOLI: High-affinity zinc uptake system protein ZnuA (znuA) from Escherichia coli (strain K12)

KEGG orthology group: K09815, zinc transport system substrate-binding protein (inferred from 95% identity to enc:ECL_01441)

MetaCyc: 84% identical to Zn2+ ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-63-RXN [EC: 7.2.2.20]

Predicted SEED Role

"Zinc ABC transporter, periplasmic-binding protein ZnuA" in subsystem Transport of Zinc

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.20

Protein Sequence (319 amino acids)

>EX28DRAFT_0699 ABC-type Zn2+ transport system, periplasmic component/surface adhesin (Enterobacter asburiae PDN3)
MISRIMLHKNTLLFAALSAALWGTTAQDVNAAVVASLKPLGFIASAIADGVTETQVLLPD
GASEHDYSLRPSDVKRLQNADLVVWIGPEMEAFMQKSAKQVAGEKQVAIAELSGVKPLLM
KGADDDGDEHDHHAADGEKGDGDHHHGEYNMHLWLSPEIARLSAVAIHDKLVELMPQSRA
KLDANLKDFEAQLAATDKQVGNELAPLKGKGYFVFHDAYGYYEKHYGLTPLGHFTVNPEI
QPGAQRLHEIRTQLVEQKATCVFAEPQFRPAVVEAVARGTSVRMGTLDPLGTNIQLSKAS
YSQFLSQLANQYASCLKGE