Protein Info for EX28DRAFT_0693 in Enterobacter asburiae PDN3

Annotation: DNA-binding regulatory protein, YebC/PmpR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 TIGR01033: DNA-binding regulatory protein, YebC/PmpR family" amino acids 1 to 236 (236 residues), 352.4 bits, see alignment E=6.9e-110 PF20772: TACO1_YebC_N" amino acids 5 to 75 (71 residues), 108.3 bits, see alignment E=2.3e-35 PF01709: Transcrip_reg" amino acids 82 to 235 (154 residues), 209.6 bits, see alignment E=2.3e-66

Best Hits

Swiss-Prot: 98% identical to Y2343_KLEP7: Probable transcriptional regulatory protein KPN78578_23430 (KPN78578_23430) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: None (inferred from 94% identity to eco:b1864)

Predicted SEED Role

"FIG000859: hypothetical protein YebC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (246 amino acids)

>EX28DRAFT_0693 DNA-binding regulatory protein, YebC/PmpR family (Enterobacter asburiae PDN3)
MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGDPASNPRLRAAVDKALSNN
MTRDTLNRAIARGVGGDEDANMETIIYEGYGPGGTAVMVECLSDNRNRTVAEVRHAFTKT
GGNLGTDGSVAYLFSKKGVISFEKGDEDAIMEAALEAGAEDVVTFDDGAIDVYTAWEEMG
AVRDALEAAGLKADNAEVSMIPSTKADMDAETAPKLLRLIDMLEDCDDVQEVYHNGEISD
EVAATL