Protein Info for EX28DRAFT_0677 in Enterobacter asburiae PDN3

Annotation: P pilus assembly protein, porin PapC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 818 PF13954: PapC_N" amino acids 13 to 159 (147 residues), 123.1 bits, see alignment E=1.4e-39 PF00577: Usher" amino acids 175 to 724 (550 residues), 640.3 bits, see alignment E=4.9e-196 PF13953: PapC_C" amino acids 733 to 795 (63 residues), 66 bits, see alignment 3.3e-22

Best Hits

Swiss-Prot: 45% identical to LPFC_SALTY: Outer membrane usher protein LpfC (lpfC) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K07347, outer membrane usher protein (inferred from 74% identity to cko:CKO_01074)

Predicted SEED Role

"type 1 fimbriae anchoring protein FimD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (818 amino acids)

>EX28DRAFT_0677 P pilus assembly protein, porin PapC (Enterobacter asburiae PDN3)
MASFSTLGREYRFSPSSLEGDMLAQQDIDLSLFSKSNAQLPGTYSSRVQVNEHRLSTTNI
VYVSSPEGSLIPQLTPDMLRAWGIAIDQYPDLLALPTNKALPKDISNYIPQASARLDFST
MTLALSIPQAALSGTGHDYIDPSRWDDGVPVLFSDYAFSGSKNKDNGDNSATSQYLNLRT
GANLGGWRVRNYSTWSNSESENQWENINTFLQHDVDALKAQFTAGESNTRGEVFDSLQYR
GVNLASDEEMLPYSQRGYAPVIRGIASSNAEVSVRQNGYLIYQQNVAPGAFEINDLYSTT
NSGDLDVTVKEADGTEHRFTQPYSSIAIMLRPGRMKYEMTAGRYRAESGSDQKEPNFFQG
SMIYGLNNLLTWFGGLTLSKDYNAANTGAGLALGPLGSLSADVTMADTRLDDNSQHTGQS
WRLLYTGKLDSTNTNFSLGSYRYSSRGYYSFADANQKRDGHEDDLLFRYNKRNRIQASVS
QTVAGVSLYLNGYQQDYWGTSKKERSLSVGLNTVIAGTSYHIAYTYSKTNDEEADRMVSL
GFSIPLARWLPRAWSSYNISNTKNGYTRQNVGLSGTLLDDERLSYSLQQSHSNHDGEDIS
SVYGSYRSQYANLTAGYYASTDNSQQLNYGISGGIVAHPQGVTLAQPLGSQFAIVNANDA
SGVRFLNQRGIQTDWQGNAVIPSLTPYQENNIRIDTSSLPENVDSSDTAITVIPSRNAAV
LARFDAHTGYRMLITLKRPNGLPVPFGAIATSSDPVMSGIVDETGTVYLAGIGETAQVTV
KWGNGTGQQCRASITQQSANHTESPNGIRSVSELCQQE