Protein Info for EX28DRAFT_0661 in Enterobacter asburiae PDN3

Annotation: Flagellar motor protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 transmembrane" amino acids 29 to 49 (21 residues), see Phobius details PF13677: MotB_plug" amino acids 13 to 67 (55 residues), 75.1 bits, see alignment E=2.6e-25 PF00691: OmpA" amino acids 161 to 259 (99 residues), 47 bits, see alignment E=2.8e-16

Best Hits

Swiss-Prot: 88% identical to MOTB_SALTY: Motility protein B (motB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02557, chemotaxis protein MotB (inferred from 97% identity to enc:ECL_01403)

Predicted SEED Role

"Flagellar motor rotation protein MotB" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (309 amino acids)

>EX28DRAFT_0661 Flagellar motor protein (Enterobacter asburiae PDN3)
MKNQSHPIVIVKKRKHKGGGHGAHGSWKIAYADFMTAMMAFFLVMWLISISSPKELIQIA
EYFRTPLATAVAGGPRISNSESPIPGGGDDYTQQKGEVKKEPNIDELKRKMEQARLKKLR
GDLDQLIEADPKLRALRPHLKIDLVQEGLRIQIIDSQNRPMFKTGSAEVEPYMRDILRGI
APVLNGIPNRISLSGHTDDFPYASGEKGYSNWELSADRANASRRELVVGGLDDGKVLRVV
GMAATMRVSDRGPDDAINRRISLLVLNQQAEQAILHENAESQNESLDDLKQPGAVPSAAV
PTSPPANPR