Protein Info for EX28DRAFT_0655 in Enterobacter asburiae PDN3

Annotation: trehalose-phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00685: trehalose-phosphatase
  • amino acids 15 to 243 (229 residues), 217.7 bits, E=2.3e-68
• TIGR01484: HAD hydrolase, family IIB
  • amino acids 17 to 213 (197 residues), 66.8 bits, E=3e-22
• PF02358: Trehalose_PPase
  • amino acids 18 to 223 (206 residues), 156.4 bits, E=7.1e-50

Best Hits

Swiss-Prot: 64% identical to OTSB_SALTY: Trehalose-phosphate phosphatase (otsB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01087, trehalose-phosphatase [EC: 3.1.3.12] (inferred from 90% identity to enc:ECL_01397)

MetaCyc: 61% identical to trehalose-6-phosphate phosphatase (Escherichia coli K-12 substr. MG1655)
Trehalose-phosphatase. [EC: 3.1.3.12]

Predicted SEED Role

"Trehalose-6-phosphate phosphatase (EC 3.1.3.12)" in subsystem Trehalose Biosynthesis (EC 3.1.3.12)

MetaCyc Pathways

• trehalose biosynthesis I (2/2 steps found)
• trehalose biosynthesis II (1/2 steps found)
• trehalose biosynthesis III (1/2 steps found)
• glycogen biosynthesis III (from α-maltose 1-phosphate) (4/8 steps found)
• mycolate biosynthesis (25/205 steps found)
• superpathway of mycolate biosynthesis (26/239 steps found)

KEGG Metabolic Maps

• Starch and sucrose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.12

Protein Sequence (267 amino acids)

>EX28DRAFT_0655 trehalose-phosphatase (Enterobacter asburiae PDN3)
MADMLTAPPVLPGHYAFFFDLDGTLAGIKPHPDQVSIPDAVLQDLHQLSLMNEGALALIS
GRSMAELDTLASPYHFPLAGVHGAERRDIHDHTHIVSLPDALTQTLQKQLSAALEALPGT
ELEAKGMAFALHYRQAPQHEEAVLALAQTFADTHPQLALQPGKCVVELKPKGINKGAAIA
AFMASPPFKGRTPVFIGDDLTDEAGFRVVNQAGGIAVKVGPGDTVAEWRLADVASVWQWI
SDIANQQQQQIAQSKGGNHYGSLSRRL