Protein Info for EX28DRAFT_0650 in Enterobacter asburiae PDN3

Annotation: anaerobic c4-dicarboxylate membrane transporter family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 transmembrane" amino acids 19 to 40 (22 residues), see Phobius details amino acids 50 to 74 (25 residues), see Phobius details amino acids 94 to 120 (27 residues), see Phobius details amino acids 136 to 160 (25 residues), see Phobius details amino acids 167 to 191 (25 residues), see Phobius details amino acids 234 to 254 (21 residues), see Phobius details amino acids 274 to 291 (18 residues), see Phobius details amino acids 302 to 322 (21 residues), see Phobius details amino acids 345 to 369 (25 residues), see Phobius details amino acids 381 to 398 (18 residues), see Phobius details amino acids 419 to 443 (25 residues), see Phobius details PF03605: DcuA_DcuB" amino acids 5 to 379 (375 residues), 481.8 bits, see alignment E=6.8e-149 TIGR00770: transporter, anaerobic C4-dicarboxylate uptake (Dcu) family" amino acids 5 to 442 (438 residues), 529.1 bits, see alignment E=4.8e-163

Best Hits

KEGG orthology group: K07792, anaerobic C4-dicarboxylate transporter DcuB (inferred from 97% identity to enc:ECL_01391)

Predicted SEED Role

"Putative Dcu family, anaerobic C4-dicarboxylate transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (447 amino acids)

>EX28DRAFT_0650 anaerobic c4-dicarboxylate membrane transporter family protein (Enterobacter asburiae PDN3)
MITIEFVVILLCLLTGTRFGGMGLGLISGIGLFILCFVFGLQPGKPPVDVMLTILAVIGC
AATLQTAGGLNVMMQFAERLLRKHPQHITLLAPFTTWMLTFLCGTGHVVYTMFPIIADIA
LKKGIRPERPMAVASVASQMAITASPVSVAVVSLVSILAAQHGIGHAWGILEILAVSVPA
SLFGVAIAALWSLSRGKDLADDIEFQEKLKDPKQREFIYGGTETLMNQRFPKQAYWSTWI
FFAGIAVVVLLGAFPELRPAFEVKGKMTALSMNLVIQMMMLIAGAVMLMACKVNASAISN
GAVFKAGMVAIFSVFGVAWMSDTFFQAHLDELKLALEGVVKSHPWTYAIVLFLVSKLVNS
QAAALTAVAPMGLMLGIDPKMLIAFFPASYGYFVLPTYPSDLACIGFDRSGTTRIGKFII
NHSFILPGLIGVSCACAASYLLVQTFF