Protein Info for EX28DRAFT_0642 in Enterobacter asburiae PDN3

Annotation: Branched-chain amino acid ABC-type transport system, permease components

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 transmembrane" amino acids 13 to 36 (24 residues), see Phobius details amino acids 43 to 62 (20 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 100 to 119 (20 residues), see Phobius details amino acids 150 to 171 (22 residues), see Phobius details amino acids 200 to 222 (23 residues), see Phobius details amino acids 230 to 263 (34 residues), see Phobius details amino acids 277 to 296 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 9 to 288 (280 residues), 163.7 bits, see alignment E=2.6e-52

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 98% identity to enc:ECL_01381)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (304 amino acids)

>EX28DRAFT_0642 Branched-chain amino acid ABC-type transport system, permease components (Enterobacter asburiae PDN3)
MSTFFLQQLINGLTLGSVYGLIAIGYTMVYGIIGMINFAHGEVYMISAYLCAIGLALLSF
FGLQSFPLLILGTLVFTIVVTGVYGWTIERIAYKPLRNSTRLAPLISAIGMSLILQNYAQ
LSQGPRQQGVPTMLDGVIRLHLGDGFVQITYTKVFILVASFAGMLVLTWIINHTRLGRMC
RAVQQDRKMASILGINTDRIISLVFVIGAAMAGLAGVLITMNYGTFDFYVGFVIGIKAFT
AAVLGGIGSLPGAMLGGLILGVAEAQFSGMVNSDYKDVFSFGLLVMILIFRPQGLLGRPI
VAKV