Protein Info for EX28DRAFT_0630 in Enterobacter asburiae PDN3

Annotation: ABC-type polar amino acid transport system, ATPase component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 PF00005: ABC_tran" amino acids 19 to 173 (155 residues), 130.4 bits, see alignment E=1.4e-41 PF13401: AAA_22" amino acids 29 to 200 (172 residues), 28 bits, see alignment E=4.9e-10 PF13304: AAA_21" amino acids 142 to 204 (63 residues), 28.2 bits, see alignment E=3.7e-10

Best Hits

Swiss-Prot: 92% identical to YECC_ECOLI: L-cystine transport system ATP-binding protein YecC (yecC) from Escherichia coli (strain K12)

KEGG orthology group: K10010, cystine transport system ATP-binding protein [EC: 3.6.3.-] (inferred from 98% identity to enc:ECL_01371)

MetaCyc: 92% identical to cystine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-290 [EC: 7.4.2.12]; 7.4.2.12 [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]

Predicted SEED Role

"Cystine ABC transporter, ATP-binding protein"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.- or 7.4.2.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (250 amino acids)

>EX28DRAFT_0630 ABC-type polar amino acid transport system, ATPase component (Enterobacter asburiae PDN3)
MSAIDVKNLVKKFHGQTVLHGIDLEVEQGEVVAIIGPSGSGKTTLLRSINLLEQPEGGTI
RVGEITIDTGKSISQQKGLIRRLRQHVGFVFQNFNLFPHRTVLENIIEGPVIVKGESKED
ATARARELLAKVGLAGKETSYPRRLSGGQQQRVAIARALAMRPDVILFDEPTSALDPELV
GEVLNTIRQLAQEKRTMVIVTHEMSFARDVADRAIFMDQGRIVEQGPAKSLFANPQQPRT
RQFLEKFLMQ