Protein Info for EX28DRAFT_0610 in Enterobacter asburiae PDN3

Annotation: Flagellar basal body-associated protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 signal peptide" amino acids 1 to 15 (15 residues), see Phobius details transmembrane" amino acids 16 to 33 (18 residues), see Phobius details PF03748: FliL" amino acids 58 to 154 (97 residues), 69.9 bits, see alignment E=1.2e-23

Best Hits

Swiss-Prot: 83% identical to FLIL_SALTY: Flagellar protein FliL (fliL) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02415, flagellar FliL protein (inferred from 87% identity to ent:Ent638_2535)

Predicted SEED Role

"Flagellar biosynthesis protein FliL" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (156 amino acids)

>EX28DRAFT_0610 Flagellar basal body-associated protein (Enterobacter asburiae PDN3)
MTDSAITKKSKRSIWIPLLVLITLAACATAGYSYWRMQQEPTTAAAKAEAPPPPAPVFFP
LDTFTVNLGDADRVLYVGITLRLKDEATRSRLNDYLPEVRSRLLLLFSRQDASALATDVG
KQKLVDAIKQTLATPLVNGQPKQEVTDVLYTAFILR