Protein Info for EX28DRAFT_0608 in Enterobacter asburiae PDN3

Annotation: flagellar motor switch protein FliN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 137 PF16973: FliN_N" amino acids 1 to 49 (49 residues), 66.2 bits, see alignment E=2e-22 TIGR02480: flagellar motor switch protein FliN" amino acids 53 to 128 (76 residues), 113.3 bits, see alignment E=1.9e-37 PF01052: FliMN_C" amino acids 56 to 126 (71 residues), 92.3 bits, see alignment E=1.5e-30

Best Hits

Swiss-Prot: 96% identical to FLIN_SALTY: Flagellar motor switch protein FliN (fliN) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02417, flagellar motor switch protein FliN/FliY (inferred from 92% identity to ecy:ECSE_2177)

Predicted SEED Role

"Flagellar motor switch protein FliN" in subsystem Bacterial Chemotaxis or Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (137 amino acids)

>EX28DRAFT_0608 flagellar motor switch protein FliN (Enterobacter asburiae PDN3)
MSDMNNPSDENSGALDDLWADALNEQKAPPAKSAADAVFQQLGGGDVSGTLQDIDLIMDI
PVKLTVELGRTRMTIKELLRLTQGSVVALDGLAGEPLDILINGYLIAQGEVVVVADKYGV
RITDIITPSERMRRLSR