Protein Info for EX28DRAFT_0593 in Enterobacter asburiae PDN3

Annotation: DNA-methyltransferase (dcm)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 transmembrane" amino acids 435 to 448 (14 residues), see Phobius details PF18284: DNA_meth_N" amino acids 18 to 74 (57 residues), 59 bits, see alignment 3.7e-20 PF00145: DNA_methylase" amino acids 86 to 447 (362 residues), 257.3 bits, see alignment E=2.5e-80 TIGR00675: DNA (cytosine-5-)-methyltransferase" amino acids 88 to 449 (362 residues), 340.6 bits, see alignment E=6.7e-106

Best Hits

Swiss-Prot: 81% identical to DCM_ECO57: DNA-cytosine methyltransferase (dcm) from Escherichia coli O157:H7

KEGG orthology group: K00558, DNA (cytosine-5-)-methyltransferase [EC: 2.1.1.37] (inferred from 93% identity to enc:ECL_03242)

MetaCyc: 81% identical to DNA-cytosine methyltransferase (Escherichia coli K-12 substr. MG1655)
DNA (cytosine-5-)-methyltransferase. [EC: 2.1.1.37]

Predicted SEED Role

"DNA-cytosine methyltransferase (EC 2.1.1.37)" (EC 2.1.1.37)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.37

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (471 amino acids)

>EX28DRAFT_0593 DNA-methyltransferase (dcm) (Enterobacter asburiae PDN3)
MTEPAPEQAEKSTATVQALLRQLLDIYDAKTLASLLVAHGESHWSPAILKRLLTSERAGR
RLSEGEFRYLQNLLPRPPAAHPNYAFRFIDLFAGIGGIRHGFEAIGGQCVFTSEWNKHAV
RTYKANWYCDPHEHHFNADIRDVTLSHKSGVSDEHAAEHIRQTIPAHDVLLAGFPCQPFS
LAGVSKKNALGRAHGFACDTQGTLFFDVARIIDACRPAIFVLENVKNLKSHDGGKTFRII
MQTLDELGYDVADSQDMGADDPKIIDGKHFLPQHRERIVLVGFRRDLNLKGDFTLRDIPS
LYPERRPTVADLLEPVVDAKFILTPVLWKYLYRYAKKHQAKGNGFGFGMVNPNDPRSVTR
TLSARYYKDGAEILIDRGWDKALGEKDFDDPHNQRHRPRRLTPRECARLMGFETPQGYRF
RIPVSDTQAYRQFGNSVVVPAFAAVAKLLASRIRQAVALRQGEAVNDGCSR