Protein Info for EX28DRAFT_0563 in Enterobacter asburiae PDN3

Annotation: Uncharacterized protein conserved in bacteria

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03734: YkuD
  • amino acids 96 to 228 (133 residues), 78.9 bits, E=6.1e-26
• PF17969: Ldt_C
  • amino acids 233 to 295 (63 residues), 54 bits, E=2.2e-18

Best Hits

Swiss-Prot: 82% identical to ERFK_SALTY: Probable L,D-transpeptidase ErfK/SrfK (erfK) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 89% identity to enc:ECL_03325)

MetaCyc: 82% identical to L,D-transpeptidase LdtA (Escherichia coli K-12 substr. MG1655)
RXN0-5401

Predicted SEED Role

"L,D-transpeptidase ErfK"

Protein Sequence (298 amino acids)

>EX28DRAFT_0563 Uncharacterized protein conserved in bacteria (Enterobacter asburiae PDN3)
MIRLTWFVLTLCAAVPGAFAVTYTLPPEGSRLVGNPIIITVPEGNTLPLEAFAAQYGQGL
SNMLEANPGVDPFLPKSGTRLVIPQQLILPDTVREGIIVNAAEMRLYYYPPGGNTVEVLP
IGIGQAGRETPRNWVTAVERKQEGPTWSPTPNTRRAYAAEGKTLPAFVPAGPDNPMGLYA
IYIGRLYAIHGTNSNFGIGLRVSQGCIRLRNNDIKYLFDNVPVGTRVQLIDRPVKSTTEL
DGSRWVEVHEPLSRNRAEFESTSKVPLPISAAQRTQLINEGAGAELERRSGMPVKFGN