Protein Info for EX28DRAFT_0527 in Enterobacter asburiae PDN3
Annotation: glucose-1-phosphate thymidylyltransferase, short form
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 78% identical to RMLA_YEREN: Glucose-1-phosphate thymidylyltransferase (rmlA) from Yersinia enterocolitica
KEGG orthology group: K00973, glucose-1-phosphate thymidylyltransferase [EC: 2.7.7.24] (inferred from 82% identity to ecz:ECS88_2130)MetaCyc: 76% identical to glucose-1-phosphate thymidylyltransferase 2 (Escherichia coli K-12 substr. MG1655)
Glucose-1-phosphate thymidylyltransferase. [EC: 2.7.7.24]
Predicted SEED Role
"Glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 2.7.7.24)
MetaCyc Pathways
- superpathway of enterobacterial common antigen biosynthesis (9/10 steps found)
- dTDP-N-acetylthomosamine biosynthesis (4/4 steps found)
- O-antigen building blocks biosynthesis (E. coli) (9/11 steps found)
- dTDP-β-L-rhamnose biosynthesis (4/5 steps found)
- dTDP-4-O-demethyl-β-L-noviose biosynthesis (3/5 steps found)
- dTDP-β-D-fucofuranose biosynthesis (2/4 steps found)
- dTDP-6-deoxy-α-D-allose biosynthesis (2/4 steps found)
- dTDP-N-acetylviosamine biosynthesis (2/4 steps found)
- dTDP-L-daunosamine biosynthesis (3/6 steps found)
- dTDP-sibirosamine biosynthesis (3/6 steps found)
- dTDP-α-D-mycaminose biosynthesis (2/5 steps found)
- dTDP-3-acetamido-α-D-fucose biosynthesis (2/5 steps found)
- dTDP-3-acetamido-3,6-dideoxy-α-D-glucose biosynthesis (2/5 steps found)
- dTDP-β-L-digitoxose biosynthesis (3/7 steps found)
- dTDP-β-L-olivose biosynthesis (3/7 steps found)
- dTDP-α-D-ravidosamine and dTDP-4-acetyl-α-D-ravidosamine biosynthesis (2/6 steps found)
- dTDP-D-desosamine biosynthesis (2/6 steps found)
- dTDP-β-L-4-epi-vancosamine biosynthesis (3/8 steps found)
- dTDP-β-L-megosamine biosynthesis (3/8 steps found)
- dTDP-β-L-mycarose biosynthesis (2/7 steps found)
- dTDP-α-D-forosamine biosynthesis (3/9 steps found)
- dTDP-α-D-olivose, dTDP-α-D-oliose and dTDP-α-D-mycarose biosynthesis (3/9 steps found)
- superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (6/19 steps found)
- superpathway of novobiocin biosynthesis (4/19 steps found)
- superpathway of erythromycin biosynthesis (2/19 steps found)
- superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)
- superpathway of megalomicin A biosynthesis (3/22 steps found)
- superpathway of dTDP-glucose-derived antibiotic building blocks biosynthesis (3/23 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.7.7.24
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (290 amino acids)
>EX28DRAFT_0527 glucose-1-phosphate thymidylyltransferase, short form (Enterobacter asburiae PDN3) MKGIILAGGSGTRLHPITRGVSKQLLPIYDKPMVYYPMSVLMLAGIRDILLITTPEDMPS FKRLLGDGSRFGINLSYEIQPSPDGLAQAFIIGEEFIAGDKCALVLGDNIFFGQSFGRKL ESVVSGNAGATVFGYQVMDPERFGVVEFDENFKALSIEEKPAAPKSNWAVTGLYFYDENV VDMAKCVKPSARGELEITTLNEMYLEQGNLQVELLGRGFAWLDTGTHDSLIEASQFIHTI EKRQGFKIACLEEIAYRNGWLTESEVMTYGNEMSKTNYGQYLLNLIKNSK