Protein Info for EX28DRAFT_0525 in Enterobacter asburiae PDN3

Annotation: Bacterial transferase hexapeptide (six repeats)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00132: Hexapep
  • amino acids 125 to 157 (33 residues), 36.1 bits, 1.8e-13

Best Hits

KEGG orthology group: None (inferred from 43% identity to rfr:Rfer_1261)

Predicted SEED Role

"Serine acetyltransferase (EC 2.3.1.30)" in subsystem Conserved gene cluster possibly involved in RNA metabolism or Cysteine Biosynthesis or Methionine Biosynthesis (EC 2.3.1.30)

MetaCyc Pathways

• superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
• L-cysteine biosynthesis I (2/2 steps found)
• L-cysteine biosynthesis VII (from S-sulfo-L-cysteine) (3/4 steps found)
• L-cysteine biosynthesis VI (reverse transsulfuration) (5/7 steps found)
• seleno-amino acid biosynthesis (plants) (3/5 steps found)
• N-3-oxalyl-L-2,3-diaminopropanoate biosynthesis (1/4 steps found)
• D-cycloserine biosynthesis (1/6 steps found)
• superpathway of seleno-compound metabolism (6/19 steps found)

KEGG Metabolic Maps

• Cysteine metabolism
• Sulfur metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.30

Use Curated BLAST to search for 2.3.1.30

Protein Sequence (178 amino acids)

>EX28DRAFT_0525 Bacterial transferase hexapeptide (six repeats) (Enterobacter asburiae PDN3)
MFKFVKDDVLRYYKLTGRNKSKVSILGIISAFFGMKMTPVILYRMSHFCFKKKIPILGKV
FSLINFVVFGVEIASNCEIGGGFFIPHSQGIVIGASKIGVNATIYQQVTLGAKNIDIPFN
HLNRPVLGDNVVIASGAKVLGGIRIGDNVIVAANAVVMHSCDNNVLLVGIPAVVKKSI