Protein Info for EX28DRAFT_0517 in Enterobacter asburiae PDN3

Annotation: UDP-N-acetylmuramyl pentapeptide phosphotransferase/UDP-N-acetylglucosamine-1-phosphate transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 46 to 65 (20 residues), see Phobius details amino acids 71 to 90 (20 residues), see Phobius details amino acids 102 to 121 (20 residues), see Phobius details amino acids 131 to 150 (20 residues), see Phobius details amino acids 159 to 180 (22 residues), see Phobius details amino acids 186 to 205 (20 residues), see Phobius details amino acids 213 to 233 (21 residues), see Phobius details amino acids 239 to 259 (21 residues), see Phobius details amino acids 289 to 310 (22 residues), see Phobius details amino acids 316 to 336 (21 residues), see Phobius details PF00953: Glycos_transf_4" amino acids 75 to 231 (157 residues), 109.7 bits, see alignment E=7.2e-36

Best Hits

KEGG orthology group: K13007, Fuc2NAc and GlcNAc transferase [EC: 2.4.1.-] (inferred from 50% identity to pst:PSPTO_1755)

Predicted SEED Role

"Undecaprenyl-phosphate N-acetylglucosaminyl 1-phosphate transferase (EC 2.7.8.-)" in subsystem Methicillin resistance in Staphylococci or Teichoic and lipoteichoic acids biosynthesis (EC 2.7.8.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-, 2.7.8.-

Use Curated BLAST to search for 2.4.1.- or 2.7.8.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (344 amino acids)

>EX28DRAFT_0517 UDP-N-acetylmuramyl pentapeptide phosphotransferase/UDP-N-acetylglucosamine-1-phosphate transferase (Enterobacter asburiae PDN3)
MLYLGIVVFAFFISCALTWGLRLYAIKNNVIDQPNQRSSHSVPTPRGGGVAIVLTLLASL
VWLVLTNHITQATFLGFFVPGLLIAVIGFLDDHGHIAARWRLLMHFIAAAIGLFYLGSFP
SINMFGYDVSLSWFGMILGSIYLVWMLNLYNFMDGINGLASAQAITFSLCSILIITINNY
SDSSDAMTMLALALAGSVAGFIVWNFPVARIFMGDAGSGFLGITIGLMILYFAKLDSRVL
IAELCLLGVFIVDATTTLLRRLLAGKKVYEAHASHCYQILARKYKSHVPVTMAAIAINFM
WLLPIAYLIISAKIDGIVGIIIAWLPLIILVFRCGAGVKDKEKA