Protein Info for EX28DRAFT_0515 in Enterobacter asburiae PDN3

Annotation: dTDP-glucose 4,6-dehydratase (EC 4.2.1.46)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04321: RmlD_sub_bind
  • amino acids 1 to 329 (329 residues), 49.1 bits, E=1.3e-16
• TIGR01181: dTDP-glucose 4,6-dehydratase
  • amino acids 2 to 344 (343 residues), 509.1 bits, E=2.2e-157
• PF01370: Epimerase
  • amino acids 3 to 259 (257 residues), 241.3 bits, E=3e-75
• PF02719: Polysacc_synt_2
  • amino acids 3 to 113 (111 residues), 54.7 bits, E=2.9e-18
• PF16363: GDP_Man_Dehyd
  • amino acids 4 to 330 (327 residues), 306.2 bits, E=1.1e-94
• PF01073: 3Beta_HSD
  • amino acids 4 to 242 (239 residues), 47.8 bits, E=3.1e-16
• PF07993: NAD_binding_4
  • amino acids 73 to 196 (124 residues), 31.4 bits, E=3.4e-11

Best Hits

Swiss-Prot: 88% identical to RMLB_SHIFL: dTDP-glucose 4,6-dehydratase (rfbB) from Shigella flexneri

KEGG orthology group: K01710, dTDP-glucose 4,6-dehydratase [EC: 4.2.1.46] (inferred from 87% identity to cro:ROD_21771)

MetaCyc: 87% identical to dTDP-glucose 4,6-dehydratase 1 (Escherichia coli K-12 substr. MG1655)
dTDP-glucose 4,6-dehydratase. [EC: 4.2.1.46]

Predicted SEED Role

"dTDP-glucose 4,6-dehydratase (EC 4.2.1.46)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 4.2.1.46)

MetaCyc Pathways

• superpathway of enterobacterial common antigen biosynthesis (9/10 steps found)
• dTDP-N-acetylthomosamine biosynthesis (4/4 steps found)
• O-antigen building blocks biosynthesis (E. coli) (9/11 steps found)
• dTDP-β-L-rhamnose biosynthesis (4/5 steps found)
• dTDP-4-O-demethyl-β-L-noviose biosynthesis (3/5 steps found)
• dTDP-β-D-fucofuranose biosynthesis (2/4 steps found)
• dTDP-6-deoxy-α-D-allose biosynthesis (2/4 steps found)
• dTDP-N-acetylviosamine biosynthesis (2/4 steps found)
• dTDP-L-daunosamine biosynthesis (3/6 steps found)
• dTDP-sibirosamine biosynthesis (3/6 steps found)
• dTDP-α-D-mycaminose biosynthesis (2/5 steps found)
• dTDP-3-acetamido-α-D-fucose biosynthesis (2/5 steps found)
• dTDP-3-acetamido-3,6-dideoxy-α-D-glucose biosynthesis (2/5 steps found)
• dTDP-β-L-digitoxose biosynthesis (3/7 steps found)
• dTDP-β-L-olivose biosynthesis (3/7 steps found)
• dTDP-α-D-ravidosamine and dTDP-4-acetyl-α-D-ravidosamine biosynthesis (2/6 steps found)
• dTDP-D-desosamine biosynthesis (2/6 steps found)
• dTDP-β-L-4-epi-vancosamine biosynthesis (3/8 steps found)
• dTDP-β-L-megosamine biosynthesis (3/8 steps found)
• dTDP-β-L-mycarose biosynthesis (2/7 steps found)
• dTDP-α-D-forosamine biosynthesis (3/9 steps found)
• dTDP-α-D-olivose, dTDP-α-D-oliose and dTDP-α-D-mycarose biosynthesis (3/9 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (6/19 steps found)
• superpathway of novobiocin biosynthesis (4/19 steps found)
• superpathway of erythromycin biosynthesis (2/19 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)
• superpathway of megalomicin A biosynthesis (3/22 steps found)
• superpathway of dTDP-glucose-derived antibiotic building blocks biosynthesis (3/23 steps found)

KEGG Metabolic Maps

• Biosynthesis of vancomycin group antibiotics
• Polyketide sugar unit biosynthesis
• Streptomycin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.46

Use Curated BLAST to search for 4.2.1.46

Protein Sequence (360 amino acids)

>EX28DRAFT_0515 dTDP-glucose 4,6-dehydratase (EC 4.2.1.46) (Enterobacter asburiae PDN3)
MKILVTGGAGFIGSAVVRHIIKNTQDDVVNVDKLTYAGNLESLSEVSDSGRYAFEHADIC
DKDAMDRIFAKHKPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARAYWSTLDE
QAKKAFRFHHISTDEVYGDLPHPDEHPASTELPLFTETTAYAPSSPYSASKASSDHLVRA
WLRTYGFPTIVTNCSNNYGPYHFPEKLIPLVILNALDGKALPVYGKGDQIRDWLYVEDHA
RALYTVVTQGKPGETYNIGGHNEKQNLDVVHTICDLLDEIVPKEGSYRDQITYVADRPGH
DRRYAIDANKISAELGWTPQETFESGIRKTVEWYLTNTEWVENVKSGNYKSWIAQNYQNR