Protein Info for EX28DRAFT_0484 in Enterobacter asburiae PDN3

Annotation: RND family efflux transporter, MFP subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 62 to 390 (329 residues), 261.7 bits, see alignment E=4.1e-82 PF25917: BSH_RND" amino acids 86 to 229 (144 residues), 104.2 bits, see alignment E=7.7e-34 PF25973: BSH_CzcB" amino acids 87 to 220 (134 residues), 31.5 bits, see alignment E=4.1e-11 PF25876: HH_MFP_RND" amino acids 127 to 196 (70 residues), 95.8 bits, see alignment E=4.6e-31 PF25944: Beta-barrel_RND" amino acids 233 to 316 (84 residues), 117.5 bits, see alignment E=8.4e-38 PF25967: RND-MFP_C" amino acids 320 to 381 (62 residues), 96.8 bits, see alignment E=1.7e-31 PF25975: CzcB_C" amino acids 322 to 378 (57 residues), 28.1 bits, see alignment 4.7e-10

Best Hits

Swiss-Prot: 90% identical to MDTA_ENT38: Multidrug resistance protein MdtA (mdtA) from Enterobacter sp. (strain 638)

KEGG orthology group: K07799, putative multidrug efflux transporter MdtA (inferred from 96% identity to enc:ECL_03401)

MetaCyc: 84% identical to multidrug efflux pump membrane fusion protein MdtA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-352; TRANS-RXN-353; TRANS-RXN-92

Predicted SEED Role

"Probable RND efflux membrane fusion protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (400 amino acids)

>EX28DRAFT_0484 RND family efflux transporter, MFP subunit (Enterobacter asburiae PDN3)
MKGSNKSRWAIAAGIIVVVLAAAWYWHSQSANSAAPAGASSQAQRPAGGGRHGMRGGALA
PVQAATAVNKAVPRYLTGLGTITAANTVTVRSRVDGQLMAIHFQEGQQVKAGDLLAEIDP
SQFKVALAQAQGQLAKDKATLANARRDLVRYQQLVKTNLVSRQELDTQQSLVSETQGTIK
ADEAAVASAQLQLDWSRITAPIDGRVGLKQVDIGNQISSGDTTGIVVITQTHPIDLVFTL
PESDIATVVQAQKAGKGLVVEAWDRSNKQKLSEGSLLSLDNQIDTTTGTIKLKARFNNQD
DALFPNQFVNARMLVATEENAVVIPTAALQMGNEGNFVWVLNDDNKVSKHLVKTGIQDSQ
TVVIAAGLSAGERVVTDGIDRLTEGAKVEVVEPAKQGEKS