Protein Info for EX28DRAFT_0451 in Enterobacter asburiae PDN3

Annotation: sucrose-6-phosphate hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 477 TIGR01322: sucrose-6-phosphate hydrolase" amino acids 21 to 450 (430 residues), 451.9 bits, see alignment E=1.1e-139 PF00251: Glyco_hydro_32N" amino acids 28 to 325 (298 residues), 350.6 bits, see alignment E=9.9e-109 PF08244: Glyco_hydro_32C" amino acids 351 to 474 (124 residues), 75.7 bits, see alignment E=4.1e-25

Best Hits

KEGG orthology group: K01193, beta-fructofuranosidase [EC: 3.2.1.26] (inferred from 83% identity to kpn:KPN_03261)

Predicted SEED Role

"Sucrose-6-phosphate hydrolase (EC 3.2.1.B3)" (EC 3.2.1.B3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.26, 3.2.1.B3

Use Curated BLAST to search for 3.2.1.26 or 3.2.1.B3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (477 amino acids)

>EX28DRAFT_0451 sucrose-6-phosphate hydrolase (Enterobacter asburiae PDN3)
MMYSIAKAEQELQARQGSLNLRWYPRYHLAARAGWMNDPNGLVWFDGWYHAFYQHHPYST
QWGPMHWGHARSKDLVRWEHLPVALAPEGPEDKDGCFSGSAVVDGDTLALIYTGHKFHGD
PDDEANLYQVQCLATSRDGVHFTRLGTIVDTPPGLHHFRDPKVWREGEDWYMVVGARDGE
TGQVRLYRSADLREWLDMGVLAVAEKEMGYMWECPDFFTLNGKRVLMFSPQGLAAEGFKN
RNLFQSGYLLGEWQPGQPFVREGEFVEMDRGHDFYAPQSFLTPDGRRIVIGWLDMWESPL
PEQQDGWAGMLSLPRELTLSEDNRLQMRAAREVESLRGAWFPWPISTLNNQQIVQVESCD
ALEVILRWDCANSSAEQYGICLGDGLRVYVDAQMQHLVLERHYPQYGLCGTRSVALNLND
TLNLRLFFDGSSVEVFVNDGDACLSSRIYPEAGARELALFAWTGSASLIDAGAWQLE