Protein Info for EX28DRAFT_0450 in Enterobacter asburiae PDN3

Annotation: oligosaccharide:H+ symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 48 to 67 (20 residues), see Phobius details amino acids 78 to 98 (21 residues), see Phobius details amino acids 104 to 125 (22 residues), see Phobius details amino acids 145 to 164 (20 residues), see Phobius details amino acids 170 to 187 (18 residues), see Phobius details amino acids 216 to 235 (20 residues), see Phobius details amino acids 255 to 279 (25 residues), see Phobius details amino acids 287 to 305 (19 residues), see Phobius details amino acids 311 to 332 (22 residues), see Phobius details amino acids 344 to 366 (23 residues), see Phobius details amino acids 377 to 396 (20 residues), see Phobius details PF01306: LacY_symp" amino acids 3 to 400 (398 residues), 420.5 bits, see alignment E=1e-129 TIGR00882: oligosaccharide:H+ symporter" amino acids 9 to 396 (388 residues), 417 bits, see alignment E=3.7e-129 PF12832: MFS_1_like" amino acids 13 to 346 (334 residues), 72.6 bits, see alignment E=5.3e-24 PF07690: MFS_1" amino acids 14 to 308 (295 residues), 58.4 bits, see alignment E=9.4e-20

Best Hits

Swiss-Prot: 40% identical to RAFB_ECOLX: Raffinose permease (rafB) from Escherichia coli

KEGG orthology group: K02532, MFS transporter, OHS family, lactose permease (inferred from 91% identity to kva:Kvar_0808)

Predicted SEED Role

"Sucrose permease, major facilitator superfamily" in subsystem Sucrose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (413 amino acids)

>EX28DRAFT_0450 oligosaccharide:H+ symporter (Enterobacter asburiae PDN3)
MMKTHRSHSYPLLSALLFFFFVTWSSSGSLLSIWLHQEVGLKAGDTGVIYAVLSVSALFA
QICYGFIQDKLGLRKNLLWFLTSLLVLSGPAFLLFGYLLQINVLLGSIFGGIFIGLTFNG
GIGVLESYTERVARQSQFEFGKARMWGSLGWAAATFFAGLLFNINPKLNFAVASCAGLVF
FVLLARLRVSSAPHAMQEAVSGGKVTLEDALRLLTLPRFWALVFFVIGTCIYGVYDQQFP
VYFSSQFPTLQEGNAMYGYLNSFQVFLEAAGMFCAPWLVNRLGAKNGLIFAGMVMAMRMV
ASGLVEGPVLISITKLLHAVELPVLLVSIFKYNSLHFDKRLSSTLYLVGFACTSSVIASV
LSPLAGYSYEKYGFAQSYLIMGLLVFSTTLISIFLLRSGKSSSDPLMPQPSTI