Protein Info for EX28DRAFT_0446 in Enterobacter asburiae PDN3

Annotation: Thiol-disulfide isomerase and thioredoxins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF00578: AhpC-TSA" amino acids 48 to 149 (102 residues), 48.5 bits, see alignment E=1.6e-16 PF08534: Redoxin" amino acids 50 to 153 (104 residues), 48.1 bits, see alignment E=2.2e-16 PF13905: Thioredoxin_8" amino acids 64 to 148 (85 residues), 31.2 bits, see alignment E=4.6e-11

Best Hits

Swiss-Prot: 39% identical to THIX_HAEIN: Thioredoxin-like protein HI_1115 (HI_1115) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 90% identity to enc:ECL_03423)

Predicted SEED Role

"Membrane protein, suppressor for copper-sensitivity ScsD" in subsystem Copper homeostasis: copper tolerance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (171 amino acids)

>EX28DRAFT_0446 Thiol-disulfide isomerase and thioredoxins (Enterobacter asburiae PDN3)
MDNRKISRLRRWAREGITLVLLTLAVVWGVDQYRKPTLPASFSATPMQSIDGNVHDISAL
SQERPLLIYVWATWCSICRYTTPSVNQLAEEGGNVVSIAMRSGDNAKLARWVEKKQLKMP
VINDENGALSQQWQVSVTPTLVIVSKGNVVSTTTGWTSYWGLKTRMWWAGL