Protein Info for EX28DRAFT_0442 in Enterobacter asburiae PDN3

Annotation: Predicted integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 110 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF11776: RcnB" amino acids 50 to 99 (50 residues), 62.3 bits, see alignment E=1.6e-21

Best Hits

Swiss-Prot: 62% identical to RCNB_ECOLI: Nickel/cobalt homeostasis protein RcnB (rcnB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 89% identity to ent:Ent638_2718)

Predicted SEED Role

"Uncharacterized protein YohN precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (110 amino acids)

>EX28DRAFT_0442 Predicted integral membrane protein (Enterobacter asburiae PDN3)
MAKRKLLLMGVLLSLAGSAFAAPQTAAAPSGIKAYEEQEFIADFTKFKIGDTAPAQYQTP
EYTIKQYQLRNLPAPDAGTHWTYMGENYVLIGDADGKIYKAYNGDIFYHR