Protein Info for EX28DRAFT_0436 in Enterobacter asburiae PDN3

Annotation: Putative regulator of cell autolysis

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 561 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 44 to 62 (19 residues), see Phobius details amino acids 74 to 95 (22 residues), see Phobius details amino acids 105 to 128 (24 residues), see Phobius details amino acids 139 to 162 (24 residues), see Phobius details amino acids 168 to 195 (28 residues), see Phobius details PF07694: 5TM-5TMR_LYT" amino acids 28 to 196 (169 residues), 203.6 bits, see alignment E=3.3e-64 PF13185: GAF_2" amino acids 243 to 352 (110 residues), 32 bits, see alignment E=2.8e-11 PF06580: His_kinase" amino acids 371 to 448 (78 residues), 88.7 bits, see alignment E=5e-29 PF02518: HATPase_c" amino acids 468 to 557 (90 residues), 27.4 bits, see alignment E=7.9e-10

Best Hits

Swiss-Prot: 87% identical to BTSS_SHIFL: Sensor histidine kinase BtsS (btsS) from Shigella flexneri

KEGG orthology group: K02478, two-component system, LytT family, sensor kinase [EC: 2.7.13.3] (inferred from 98% identity to enc:ECL_03436)

MetaCyc: 87% identical to high-affinity pyruvate receptor (Escherichia coli K-12 substr. MG1655)
Histidine kinase. [EC: 2.7.13.3]

Predicted SEED Role

"Autolysis histidine kinase LytS" in subsystem Murein hydrolase regulation and cell death

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (561 amino acids)

>EX28DRAFT_0436 Putative regulator of cell autolysis (Enterobacter asburiae PDN3)
MYEFNLVLLLLQQMCVFLVIAWLMSKTRLFIPLMQVTVRLPHKLLCYVTFSIFCIMGTYF
GLHIEDSIANTRAIGAVMGGLLGGPVVGGLVGLTGGLHRYSMGGMTALSCMISTIVEGLL
GGLVHSYMIKRGRPDKVFSPLTAGAITFVAEVAQMAIILLIARPFEDALHLVSSIAAPMM
VTNTVGAALFMRILLDKRAMFEKYTSAFSATALKVAASTEGILRQGFNEENSMKVAQVLY
KELDIGAVAITDRERLLAFTGTGDDHHLPGKPISSAYTLRAIETGEVVYADGNEVPYRCS
LHPQCKLGSTLVIPLRGENQRVMGTIKLYEAKNRLFSSINRTLGEGIAQLLSAQILAGQY
ERQKALLTQSEIKLLHAQVNPHFLFNALNTLKAVIRRDSDQAAQLVQFLSTFFRKNLKRP
SEIVTLADEIEHVNAYLQIEQARFQSRLQVSLSVPDELAYQHLPAFTLQPIVENAIKHGT
SQLLGTGEITIAASRFNHHLVLDIEDNAGLYQPSASGGLGMSLVDKRLRAHFGDDCGITV
ACEPDRFTRITVRLPLEENAC