Protein Info for EX28DRAFT_0435 in Enterobacter asburiae PDN3

Annotation: Predicted transcriptional regulators

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 transmembrane" amino acids 135 to 156 (22 residues), see Phobius details PF13411: MerR_1" amino acids 4 to 71 (68 residues), 59.7 bits, see alignment E=5e-20 PF00376: MerR" amino acids 5 to 42 (38 residues), 45.5 bits, see alignment 1.1e-15 PF22270: MlrA_helical" amino acids 81 to 155 (75 residues), 114.6 bits, see alignment E=3.4e-37 PF22267: MlrA_C" amino acids 162 to 238 (77 residues), 113.5 bits, see alignment E=8.9e-37

Best Hits

Swiss-Prot: 78% identical to MLRA_ECOLI: HTH-type transcriptional regulator MlrA (mlrA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 84% identity to ent:Ent638_2725)

Predicted SEED Role

"HTH-type transcriptional regulator mlrA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (246 amino acids)

>EX28DRAFT_0435 Predicted transcriptional regulators (Enterobacter asburiae PDN3)
MALYTIGEVALLCDINPVTLRAWQRRYGLLKPQRTDGGHRLFNEADIDRIREIKSWIDNG
VQVGKVKSLLSHDDPDTQHLWREQQETLLRLLQAGNLQRLRAWIKEQGRDYPAQTLISHL
FIPLRRRLQCQQSTLQALLSILDGVLINYIAVCLASAKNKAGKDALVVGWNVHDTTRLWL
EAWIATQKGWRVDVLAHSLAQLKPEFFDGQTLLVWCGEVPSATQQQLLTEWRENGYPVYS
LGPDEP