Protein Info for EX28DRAFT_0427 in Enterobacter asburiae PDN3

Annotation: Sortase and related acyltransferases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 transmembrane" amino acids 61 to 79 (19 residues), see Phobius details PF13302: Acetyltransf_3" amino acids 12 to 150 (139 residues), 30.2 bits, see alignment E=1.4e-10 PF13420: Acetyltransf_4" amino acids 19 to 169 (151 residues), 41.1 bits, see alignment E=3.8e-14 PF00583: Acetyltransf_1" amino acids 47 to 149 (103 residues), 47.3 bits, see alignment E=4.9e-16 PF13508: Acetyltransf_7" amino acids 65 to 150 (86 residues), 34.8 bits, see alignment E=3.5e-12

Best Hits

Swiss-Prot: 56% identical to PAT_ALCFA: Phosphinothricin N-acetyltransferase (pat) from Alcaligenes faecalis

KEGG orthology group: K03823, phosphinothricin acetyltransferase [EC: 2.3.1.183] (inferred from 87% identity to enc:ECL_03444)

Predicted SEED Role

"GCN5-related N-acetyltransferase"

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.183

Use Curated BLAST to search for 2.3.1.183

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (184 amino acids)

>EX28DRAFT_0427 Sortase and related acyltransferases (Enterobacter asburiae PDN3)
MSAIDVLSETELEVRDALPDDVHAIAAIYAWHVLHGRASFEEVPPTIDEMRQRMKSVAES
GLPWLIALYRGIVVGYCYATPYRPRHAYRYTLEESIYVDASITGRGFGSALMDALIARCE
QGPWRQMIAVVGDGNNNSGSLRLHKKHGFVIVGQLRSVGYKKGDWRDTVIMQRSLNDGDW
TLPE