Protein Info for EX28DRAFT_0426 in Enterobacter asburiae PDN3

Annotation: D-alanyl-D-alanine carboxypeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF00768: Peptidase_S11" amino acids 33 to 262 (230 residues), 284.4 bits, see alignment E=7.4e-89 PF13354: Beta-lactamase2" amino acids 41 to 185 (145 residues), 36.6 bits, see alignment E=2.8e-13

Best Hits

Swiss-Prot: 86% identical to PBP7_ECOLI: D-alanyl-D-alanine endopeptidase (pbpG) from Escherichia coli (strain K12)

KEGG orthology group: K07262, D-alanyl-D-alanine endopeptidase (penicillin-binding protein 7) [EC: 3.4.21.-] (inferred from 97% identity to enc:ECL_03445)

MetaCyc: 86% identical to peptidoglycan DD-endopeptidase PbpG (Escherichia coli K-12 substr. MG1655)
3.4.-.-

Predicted SEED Role

"Murein-DD-endopeptidase (EC 3.4.99.-)" in subsystem Peptidoglycan Biosynthesis (EC 3.4.99.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.- or 3.4.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (307 amino acids)

>EX28DRAFT_0426 D-alanyl-D-alanine carboxypeptidase (Enterobacter asburiae PDN3)
MLKFRVSLLSLALLLGASAAVPAVAKTPAVTAAAAQPQIASGSAMIVDLNTNKVIYASHP
DLVRPIASITKLMTAMVVLDAHLPLDEKLKVDISHTPEMKGIYSRVRLNSEISRKNMLLL
ALMSSENRAAASLAHHYPGGYDAFIRAMNAKAKALGMTNTHYVEPTGLSINNVSTARDLT
KLLIASKQYPLIGQLSTTREEMATFANPAYTLPFHNTNHLVYRDNWNIQLTKTGFTNAAG
HCLVMRTVFNGKPVALVVMDAFGKYTHFADASRLRTWIETGKVQPVPAAALTYKKQKAEQ
MATAQND