Protein Info for EX28DRAFT_0415 in Enterobacter asburiae PDN3

Annotation: GMP synthase - Glutamine amidotransferase domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 PF00117: GATase" amino acids 38 to 185 (148 residues), 66.5 bits, see alignment E=1.3e-22

Best Hits

Swiss-Prot: 59% identical to YFEJ_SALTY: Putative glutamine amidotransferase-like protein YfeJ (yfeJ) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01951, GMP synthase (glutamine-hydrolysing) [EC: 6.3.5.2] (inferred from 69% identity to pct:PC1_2713)

MetaCyc: 59% identical to gamma-L-glutamyl hydroxamate hydrolase (Salmonella enterica enterica serovar Typhimurium str. LT2)
RXN1R65-43

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.2

Use Curated BLAST to search for 6.3.5.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (238 amino acids)

>EX28DRAFT_0415 GMP synthase - Glutamine amidotransferase domain (Enterobacter asburiae PDN3)
MHIHFIIHEHFEAPGAYEIWGKNRGCSMSYSRVYHGDPLPEDLQSTDLLIIMGGPQSPAT
TLKECPWFDAQAEMRLIGRAIEAGKTVIGVCLGSQLIGEALGAAFCHSPEKEIGKFPVRL
TDAGKANPLFEDFGHELNVGHWHNDMPGLTPQAKVLAYSEGCPRQIVQYGERVYGFQCHM
ELTPEVVELLIEHSPNDLRRAAEFRFIETAEKLRSHDYREMNQVLFSFLDKLTAQRKA