Protein Info for EX28DRAFT_0407 in Enterobacter asburiae PDN3

Annotation: ABC-type sugar transport system, periplasmic component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF13407: Peripla_BP_4" amino acids 28 to 299 (272 residues), 219.3 bits, see alignment E=6.9e-69 PF00532: Peripla_BP_1" amino acids 29 to 254 (226 residues), 34.5 bits, see alignment E=1.6e-12

Best Hits

Swiss-Prot: 96% identical to DGAL_CITFR: D-galactose-binding periplasmic protein (mglB) from Citrobacter freundii

KEGG orthology group: K10540, methyl-galactoside transport system substrate-binding protein (inferred from 99% identity to enc:ECL_03459)

MetaCyc: 96% identical to D-galactose/methyl-galactoside ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-18-RXN; TRANS-RXN0-541

Predicted SEED Role

"Galactose/methyl galactoside ABC transport system, D-galactose-binding periplasmic protein MglB (TC 3.A.1.2.3)" in subsystem Bacterial Chemotaxis or Lactose and Galactose Uptake and Utilization (TC 3.A.1.2.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (332 amino acids)

>EX28DRAFT_0407 ABC-type sugar transport system, periplasmic component (Enterobacter asburiae PDN3)
MNKKVLTLSAVMASMLFGAAAHAADTRIGVTIYKYDDNFMSVVRKAIEKDAKAAPDVQLL
MNDSQNDQSKQNDQIDVLLAKGVKALAINLVDPAAAGTVIEKARGQNVPIVFFNKEPSRK
ALDSYDKAYYVGTDSKESGIIQGDLIAKHWAANPNWDLNKDGQIQFVLLKGEPGHPDAEA
RTTYVIKELNDKGLKTQQLALDTAMWDTAQAKDKMDAWLSGPNANKIEVVIANNDAMAMG
AVEALKAHNKSSIPVFGVDALPEALALVKSGAMAGTVLNDANNQAKATFDLAKNLADGKG
AADGTSWKIENKIVRVPYVGVDQSNLAEFIGK